KEGG   Solenopsis invicta (red fire ant): 105205288Help
Entry
105205288         CDS       T03916                                 

Definition
(RefSeq) uncharacterized protein LOC105205288
  KO
K17398  DNA (cytosine-5)-methyltransferase 3A [EC:2.1.1.37]
Organism
soc  Solenopsis invicta (red fire ant)
Pathway
soc00270  Cysteine and methionine metabolism
soc01100  Metabolic pathways
Module
soc_M00035  Methionine degradation
Brite
KEGG Orthology (KO) [BR:soc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    105205288
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:soc03032]
    105205288
   03036 Chromosome and associated proteins [BR:soc03036]
    105205288
Enzymes [BR:soc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     105205288
DNA replication proteins [BR:soc03032]
 Eukaryotic type
  DNA Replication Termination Factors
   DNA methylation enzymes
    105205288
Chromosome and associated proteins [BR:soc03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    105205288
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP DNA_methylase ADD_DNMT3
Motif
Other DBs
NCBI-GeneID: 105205288
NCBI-ProteinID: XP_011172937
LinkDB All DBs
Position
Unknown
AA seq 1607 aa AA seqDB search
MEEVGIGTSYGNDECVDSVDWATTFGEEERLPQSGDAADEDREEHESDVMVEHQYALMPA
MQQQEPIPKPEQHSGSSKLSTNAWAFHCALDLGLLRESSLDEVDILHIADSFELNSQSAT
EDSEKFSDPETNDREDDACKPANIFGNSWPFIDPAQIKRTTNTKPPVRRRKRKTRRKKKT
WSMRRQRKARPRIDDATADLPAKRDTSSRKSKRENFTVSHDRSARLSARANSSLTRSRVF
VGDERLPESYRSTGEDATADDDDEEEVISQTTSETSSADEIAHVDYSDSEYSRFRSSSHA
KEESQNRTELSEYPDYFMNVLRIDNSTENNHFDTWEDVTTVPDTSRDNARISKLAKITER
RASRKVLDKSASRRIGRASSRKKELELKDSEDRSEVAKKRRNRLIGREQKKIFNSTTYNH
NNRRRSSHDLEENSSRRKSRGDVAVGTRDVAKEITVQKCSDCKAQRRSYNFTNVACPCKR
KTKDMATAIMRDIQECINTKIAKDLKIIKISETEKDMLSNSKDLSRDISMEYDFMEYNLD
EDDDLDWDFPSQETIISKQSFDLVERREAMNVEELSMSFNNRARRRKKRYRYSIDCKFDE
KIETAYRSVFHDCVDFDTPRSRSSLKINMEESWKSENSSDNDDDEIHSSWRRSTLESSTE
ECGNEVDGALLLAQKIVNDDSTKDEKFDEEYEALNNTCYKYREVSNSTARDNSLYDSDVD
LENIEFINQRDEAKDIITYRNKNRTIKRSTSDCSLVKDEDDDSIGVQHKDTKNMKVVNKV
NVMRQIPRKNLEHLKHDSESDPRRVTRALVKTKTKNYKEYRAGKLVWGFFSGWWPALIIE
AEHVGMAPAPGKMWVYWLGESHISLLKEGTQIQPFSRNLEERLSQQSHKSIRTRAIDATI
QILRQRFNCTLTKPYYYWIQRNISDMETLDELTFYPYPEHILERLETLKEKNAKATKKFI
LNQKRDSPSREAPPSKKQNIEKKDVNTSWEQIDDERLCLQHQQPGVIAWAKIPGHCWWPA
MIVDYRDCCLKEPIFGCQWIMWYGDYQVSEVRHLEFLKFHKGIEKMREYIQNSNRQQYLE
GVLQASKDYCSRLGCDTDNWTLDNVFEYFSNNIHKPYNQLQVSDSNKIYDKYSSVIVNKI
NDLKFKLDVDAERKRDIKASNDLRRAMSGECEMEALCLRCLKIYKGKKEEHPFFTGSLCK
KCSDEFKPCMFVHGNDGKCFYCTICATTGTVLICDSEDCPRVYCTACLKFLLCPKSFDDM
LLEDPWECFLCRDESKQPANMILRPRLDWKKRYTRMFRTSKLTSDVDITHYKKENRPVRV
LSLFDGLSTGFLVLQKLGLVVEVYYASEIDVNALTISSAHFGDRISYLGDVRGITKEKIQ
EIAPIDLLIGGSPCNDLSLVNPARLGLHDPRGTGVLFFEYCRIKKLVEKANKDRHMFWLF
ENVASMPTEYRLEINKNLGREPDVIDSADFSPQHRLRLYWHNLPFNPYMPLFESRQNVQD
KLTPNLNREALCKKLRTVTGRKGSLLQGKAELKPIIMKGKTDTIWITELEEIFGFPRHYT
DVKNLSATNRQKILGKSWSVQTLTAILRPLCSYFKCNEDETNKETTS
NT seq 4824 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagtgggaatcggcacctcgtacgggaacgatgagtgcgtcgactcggtggac
tgggccacgacgttcggcgaggaggagcgactcccgcagagcggagatgccgcggacgag
gatcgggaggaacacgagtcggatgttatggtggaacaccagtacgcactgatgcctgct
atgcagcaacaggagccaattccaaagccggaacaacacagcggatcatcgaaattatcc
acgaatgcttgggcctttcactgcgcgttagaccttggtttgctccgcgaatcttccctc
gacgaagtcgacatactccacatcgctgattcctttgaattaaattctcagtccgccacc
gaggactcggaaaaattttctgatcccgaaacgaacgatcgcgaggatgatgcgtgcaaa
cccgcgaatatcttcggtaactcgtggccgttcatcgatccggcgcaaattaaacggacc
accaatacgaagccacctgtccggaggcgaaagaggaaaacgcggcgaaagaagaaaacg
tggtcgatgagacggcaaaggaaagcgcgtccgagaattgatgacgcaacagcagatctc
ccggccaagagagacacctcgtcgcgaaaatccaagcgagaaaattttaccgtatcgcac
gatcgctcggcgagattatcggcgagggcaaactcttcgttaacacgatctcgcgttttc
gttggcgacgaacgtttacccgaaagttacagatcgactggcgaggacgccaccgccgac
gacgatgatgaagaagaagtaattagtcaaacgacatcggagacgagctccgccgacgag
atcgcccatgttgattattccgactccgagtactccagattccgttcgtcgagtcacgcg
aaggaagagtcgcaaaatcgaacggagctatcggaatatcctgattacttcatgaacgtc
ctgcggatcgataacagcaccgagaacaatcatttcgacacctgggaggatgtaacgacg
gttcccgatacttccagagataacgcgcgaatttccaagttagcgaaaattacagaacga
cgtgcgtcgcgcaaggtcctcgataaatccgcctcgcgtcgaatcggaagagcgtcatcg
agaaagaaggagcttgagttaaaagatagcgaggatcgttccgaagtggcaaagaaaaga
agaaacagattaattggtcgggagcaaaagaaaattttcaattccactacgtacaatcat
aataatcgtaggcgaagctctcacgatttggaggagaattcttcaagacgcaaatcgaga
ggtgatgtcgctgttggtacgcgtgatgtcgcgaaggaaattacggtacagaaatgttct
gactgtaaagcgcaacggcgttcttataattttacaaatgtcgcctgcccgtgcaagagg
aaaacgaaggacatggctaccgctattatgcgggatattcaagagtgcataaacacgaaa
attgcaaaggaccttaaaattattaagatttccgaaactgagaaggatatgctctcaaat
tcgaaggatctcagtcgagatatctctatggaatatgatttcatggaatacaatttggac
gaggacgacgatcttgattgggatttcccgtctcaggaaacaatcatttcgaaacaatca
ttcgatttggtagaaagacgcgaagcaatgaatgtcgaagaattatcgatgagctttaac
aaccgtgctaggcgtcgtaaaaaaagatacagatattcgatcgattgtaaattcgatgag
aaaatagaaacggcttatcgaagcgtttttcatgattgcgttgatttcgatactccgcga
tcgagatcttccttgaaaataaacatggaggagagctggaaatcggagaacagtagcgac
aacgacgacgacgagatccactcatcctggcgccgatcgaccttagaatcctcaactgaa
gaatgcggtaacgaagttgatggcgcgctgctattggctcagaagattgttaacgacgat
tcgacaaaagacgaaaaatttgacgaggaatacgaggcgttgaataacacatgttacaag
tatcgcgaagtgtcaaattcaacggcgcgagataattctttatacgattcggacgtggat
ttggaaaatatagaattcataaatcaacgtgacgaagcgaaggatataatcacgtataga
aataaaaataggacaattaagagatcgacatcagactgcagccttgttaaggatgaagat
gatgattccattggggttcaacataaggatacgaaaaacatgaaagttgttaacaaagta
aatgtaatgcgacaaatcccacgtaaaaatttggagcatttgaagcacgatagtgaaagt
gatccacgtagagtgaccagggctctagtaaagactaaaactaaaaactataaagaatat
cgtgcaggcaaactagtatggggattcttttcaggatggtggccagcactgatcatcgaa
gctgaacatgtaggaatggctcctgcgcccggcaagatgtgggtctactggctcggagaa
tcgcacatatcgctgctcaaagaaggcacacagatacaaccgttctcgaggaacttggag
gagcgattatcgcaacagtctcataaaagtattcgtacgcgcgccattgacgcgactata
cagatactacgccaacgtttcaactgtactctgacaaagccttattattattggatacaa
cggaacatatctgatatggagacactggatgagttaacgttctatccatatccggagcat
atactagaaagactggaaaccttgaaggaaaagaatgccaaagctactaagaaatttata
ttaaatcagaaaagggattctccttccagggaggcaccaccatcgaaaaagcagaatata
gaaaaaaaagatgtaaatacaagttgggaacagatcgatgatgagcgtttatgtttgcaa
caccaacaacctggtgtaatagcctgggcgaaaatccccggacactgttggtggcccgcg
atgattgttgattatcgtgattgctgtttgaaagaaccgatttttggttgtcaatggatt
atgtggtatggagattatcaagtttcggaggtacgtcatctcgaatttctgaaatttcac
aaaggaatagaaaaaatgcgcgaatatattcaaaacagtaatagacagcagtatctcgaa
ggcgtgcttcaggcttccaaggattattgctcacgtttaggatgcgacacggataactgg
actttagataatgtttttgaatatttttcgaataatattcacaaaccgtataaccaatta
caagtttcagactctaataagatatatgataaatattccagcgtgatagtaaataaaatc
aacgatttgaagttcaagttagatgtagatgctgaacgaaagcgtgatataaaagcgagc
aatgatcttcgtcgcgcaatgtcaggagaatgcgagatggaagcattatgtttaagatgt
ctgaagatttataaaggcaaaaaggaggagcatccgttctttacgggatctttgtgtaaa
aaatgttcagacgagtttaaaccgtgtatgttcgtgcatgggaacgatggcaagtgcttt
tattgcaccatttgcgctaccaccggaaccgttcttatttgtgattcagaagattgtcca
cgtgtctactgtacggcatgtttgaaatttttgctgtgtccaaaatcattcgatgatatg
ctgttggaagatccgtgggaatgtttcctctgcagagacgaaagcaaacagcccgcgaat
atgatattgcgtccgcggttagattggaaaaagagatatacacgaatgttccgcacctct
aagctcacgtctgatgtcgatattacacattataaaaaggaaaatagacctgtgcgtgta
ctatcgcttttcgatggtttgagcactggttttttggtgctccaaaagttaggacttgtt
gtggaagtttattacgctagtgaaattgatgtaaatgcgttaacgattagctccgcccat
tttggcgatcgtatttcttatttaggagatgtaagaggcattacaaaagagaaaattcaa
gaaattgcgccaattgatttgttaattggtggatcaccatgcaatgacttgagtttggtc
aatccagcgcgattaggtcttcatgatccaagggggactggcgttctctttttcgagtat
tgccgaattaaaaaactagtagaaaaagccaacaaagatcggcacatgttttggttattc
gagaatgtcgcttccatgccaaccgagtatagattagaaattaacaagaatctaggacgg
gaacctgacgtcatagattctgcggacttttcgccccagcacagattgaggctttactgg
cataaccttccctttaatccttatatgccgctgtttgaaagccgacagaacgttcaggat
aagcttacgccaaatttgaatcgagaggctctatgcaaaaaacttcgtacagttacgggc
agaaagggttccttattacaaggaaaagcggaattaaaaccaattataatgaaaggtaaa
actgatacgatatggattaccgaactcgaggaaatcttcggttttccacgacattatacg
gatgtgaagaatttgtcagccacgaatcgacagaaaatacttggcaaatcttggagcgta
caaacacttactgccatattacgacctttatgctcatattttaagtgcaatgaagacgag
acgaataaggagactacttcttaa

DBGET integrated database retrieval system