KEGG   Solenopsis invicta (red fire ant): 105205434Help
Entry
105205434         CDS       T03916                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETD1-like
  KO
K20129  rabankyrin-5
Organism
soc  Solenopsis invicta (red fire ant)
Brite
KEGG Orthology (KO) [BR:soc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:soc04131]
    105205434
Membrane trafficking [BR:soc04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    105205434
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank_3 Ank Ank_5 N-SET SET FYVE BTB RRM_1 FYVE_2 BACK HypA
Motif
Other DBs
NCBI-GeneID: 105205434
NCBI-ProteinID: XP_011173103
LinkDB All DBs
Position
Un
AA seq 2645 aa AA seqDB search
MEDPTEAQKWQQHLSLLREQYVNLYNANAELQREYAVATAEKQEGGFVGRLLTTVASLYC
QHRYSDISIKLIDQEIPAHKFILSARTDFFSDAALVEKTVLDWSNLNSAVALVLLKWIYT
SKISQEHLTLDLMKAAAGFQLSELVDQCEKYLIGTVGLKNCVGLYSAAEELGTLKLKEHC
SSLISAHWEDLTGEDFKEIPGSLLYKLLQTKSKYPLHAAVRLMREDVVFLYLVEHNAELP
KAVNAVDHKGETALEVALKTRQPSLARTLVEHGADLSAKDTRGLSLLHSAILKGDSYSSE
FIIEQLENNGSVQKLCEAVKINEGAKNVADLKQLEGCTALHLVAKHNTENMLAVGSRLLQ
AGIDPNLQDHRGWTALHSCIFEKNEMLFDLLLAAKNIDVDQITNKDDTALCFAMKMEPFN
ENFASKLLIKGAIPNPTYDVTGDTLLHILTQERREEAALFLVEYCNNNLTKTNNEGFTIL
HEACRVGLKDLTRALLRNGLPTDVVTLSTGDAPIHFAISNLYTDIVIELLDATNLDSQLT
IKNNANETPLSLAIKAPFKKGKDIVLALIKAGADVNERNEEGLTLLHQAILKEDSATAIF
LLENGADMNTKTANGETPLQLCVHCRLGEVVEALCRRGVDTSIGCPLWDALDSDQEDTAS
ILVKHGADTDCWGPGPDGCQQTLLHRAIDDNKEDIAQFLIRSGCDLNAPRRLGPDGAGGD
EARDECTPLHLCCQWGLEQVVQTLIEHGADVNARDTEGKTPVHVAIQNQHSQIISLLLCH
PNIDLNKRDKKGLTPFATALTVRNNKAAQAILERLPKAAEQYDNKGRNFLHTAIQKGDME
SILFLLSIQVDVNSRIHDVTQTPPLHLAAVSGNEMLVRSLILAGARVNDTDANRNTALHV
AAKAGHATVVSALLQNNINFDAVNADGDNALHVAVREGHVSVVRTLLTECTLDAEAVNLK
GRNPLHELARCARDNAATICDLFLECMSQYPVNNADLDGNTPLLIAYMKGNGNLCRTLVK
AGACLGSMNKDGITIFNYQVATKQLLYRLLDSLTQEAPWSDKDCCLECGTKFSLTMRKHH
CRHCGRILCSKCSGQDVPILKFGLNKPVRVCNVCFDVLLGTGSLQPSYLEAMNGMERHGH
GHGHSHAHSHRHRHSHGSSQSTSQNSNQPSSKHSHGHVTHSQKDAAAPPATPKTQRNFKL
LVDPFLVKGATRLCRYDGTVPGDPTYPQVQPRDPRSQLTRIWTRLEQLDLPVPRFKIDAN
YCGEPPPLEVTFCHLNDNIDKIFLTNMVQKFGSIEELTIYYHPLTNKHLGIARVVFESTK
ASKVCVEKLNNTSVMGKVLRVFLDPFGEECKKMFEELTIEKKPEKKVEKEVPKPPPPEVE
QEKHQTPVEKAVPEERDDFRNNKKTILSMDKNREPYVENSRYNKYRDYPTPSGSTGSDLG
YGTAPSELNYSSNYSQNSTPATNYDFYYSSYHHQPPSSYLANIPQNVSQSIPIQQNSNVW
WGNNSGSTGYSTSTSVWPIQQHATNLDSAGSNMTPINNKTSSAKVHHTPKKEKENQTTTA
KSTPRDSPDETRKTLDLDTRIAMLLKDKAGGMAPPFLQFGSDSEDDKKSQPDNEMLSEPP
SPFLSREIYKQCFDKIVERNKERRKIHENSISHFSVDEDLGSVISSSEDEALLGSYSPAP
DDNEPEPPKDPPPPPPPDDDRMSLSPLSSGDEKIEEVIAQTEPSNQLYPAAGYPGHLTHY
PSNDVYNWPRPTQYPYPYGTTYLQSHYQPTTATFSATIGNHQGANYYSSFQSRLHAMANY
NITKDPQGPAINGVLNKVVNELKQILKKDFNKKMIENTAFKLFEVWWDEKKSEKNQTQGS
GDNIIANNTTKEDVKPQGLSSLLEQATPLGLNYDGFGLGIRASMPKMPSFRRKIKAPSPL
PQDEDSRQSGHADMETIESDSDLDVPPVQKTKKPLTSLPTVSSSSTTSSSIESSSEEVSS
SESSDSSNESSDEEACFEDEQDTDSRMSDHRPLASNSEDPDILMELAIQRSLDCPTPTGR
ETPVPDIKIKDQNSIEFPQIDDDNNLDSLLVSPVGYESVKEEERIAEKMPVAEEKPFDVY
KTLDKEIKNVSRITEDKGTQSDIKPAPMMITSAIKEETLPDMENSAAEALMTLAGQDNII
RHRSPGPVQPNIIRALQTMSAKYINDEPILKDKIEMFSEIPTTDSEEESLEIRRLRYQAE
TELRLNGQRTPSSPGSQASQVYMEHSYSLPPAQPEPIEPVIRVPPASVKVKHSKIVKLTK
SKDNTHKIEKQKSKKYTKVHSSHQNHVGEKENIRNEYIYDKLPKQVPEPTVTYKARDYMS
EMAILYEFLTRGIDAEDVEYLRRSYQAFLADDSHSYWLNDTHWVDHPPTDVPSPAKKRKR
DELRLHASGSARTEGYYKVDIREKAKHKHHYAQSIQRSNDVEDSGGSYIGGDGVMNGPKN
SSKALTGKMQALSREARSNQRRLLTAFGIDTDSDLLKFNQLKFRKKQLKFAKSGIHDWGL
FAMEPIAADEMVIEYVGQMVRPVVADLREAQYEATGIGSSYLFRIDLDTIIDATKCGNLA
RFINHSCNPNCYAKVITIESQKKIVIYSKQPIGVNEEITYDYKFPLEDDKIPCLCGAPQC
RGTLN
NT seq 7938 nt NT seq  +upstreamnt  +downstreamnt
atggaagaccccacggaggcacagaagtggcagcaacacctgtccctgctgcgggagcaa
tatgtcaatttgtacaacgcgaacgcggaactacagcgggagtacgccgtcgccacggcc
gagaagcaggagggcggatttgtcggccggcttttgacgacggtggcatccttgtactgt
cagcaccgttacagtgacataagtataaaactgattgaccaagagataccggcacataaa
ttcatactgtctgctaggactgatttcttcagcgacgccgctctcgtcgaaaagactgtt
ttagattggagcaacttgaatagtgctgttgcattggtgctactgaaatggatttacaca
agcaaaatatcccaggaacacctaacattggatttgatgaaagcagcagctggtttccaa
ctgtccgaactggtagatcagtgtgagaagtatctaattgggactgtaggcctgaaaaat
tgcgtgggattgtactcggcagccgaggaactaggcactctaaaattgaaggagcattgc
agctccttaatctctgcacattgggaagatctgacgggcgaggatttcaaggaaattcca
ggttctctgctgtacaagttactgcagactaaaagtaaatatcccttgcatgcagcggta
cgtttaatgcgtgaggacgttgtatttctatatctggtggaacacaacgccgagcttccg
aaggcggtcaatgctgtggatcacaagggagaaacggctttggaagtcgccctgaaaact
cgccagccatccctggcacgcactctggtcgagcatggagcagatctgagtgcgaaggat
acgagaggtctttctctccttcactcggctatcttgaaaggagattcctactcgtccgag
tttataatcgagcagctggagaacaacggcagcgtacaaaagttatgcgaggctgtaaaa
attaatgagggcgcgaaaaatgtagcggatcttaaacaactggaaggctgcaccgcctta
catctagtggcgaagcacaatacggaaaatatgctggcagttggctcgagactactccag
gcgggaattgatccgaacttacaagatcacaggggatggactgcgcttcacagttgtatc
tttgagaaaaacgagatgttgttcgatctgttactcgcagcaaagaatatagatgtagat
caaattacaaacaaggatgacacagcgttgtgtttcgcgatgaagatggaacccttcaac
gagaactttgcatcgaaattactaatcaagggtgccataccgaatccaacgtacgacgtc
accggagatacgttgctccatatcttgacgcaagaacgcagagaggaagcggcgttattc
ttagtggaatattgtaataataatttaacgaaaaccaacaacgaaggtttcacgatactg
cacgaagcatgcagggttggcttaaaggatctgactcgtgctctgttaagaaacgggctg
ccgaccgatgtcgttactctttctactggcgacgcgcccattcatttcgcaatttcgaat
ctgtataccgacatagtcatcgaactattggacgctacgaacttggattcgcagctgact
attaaaaacaacgcaaacgagacacctctgagtttggctataaaagcaccgttcaagaag
ggcaaagatattgtgttggctctgataaaagctggagctgatgtaaatgaacgcaacgaa
gaaggcctgacattgttgcatcaagcgatattgaaagaggattcagctacagcgatattt
ttattagaaaatggtgctgacatgaatacaaaaacagccaatggagaaacgccgttacaa
ctgtgcgtacattgtagactgggtgaagtagtggaagctctttgtaggcgaggtgtagac
acctcaataggatgcccattgtgggacgctttggattcagatcaagaagacaccgcatcg
atcttggttaaacatggagcggacactgattgctggggtccaggtcccgatggatgtcag
caaacgttattacacagagcgatcgatgataataaagaggatatcgcgcaatttctgatt
agaagtggatgtgatttgaatgctccgagacgacttggtccagatggtgctggtggagac
gaggcaagagacgagtgcacacctttacatttgtgttgtcaatggggattggaacaagtt
gttcaaacgctcatcgagcatggagccgatgtgaatgcccgtgacacagagggaaaaaca
cctgtgcacgtagcgatacagaatcagcactcgcagattatttctcttttgctatgccat
ccaaatatagatctgaataaaagagataagaagggactgacacctttcgcaaccgctctg
acagtccgcaacaacaaagccgcacaagcaatattagagagattacctaaggccgctgag
caatacgacaataaaggcagaaactttttgcatactgctatacagaagggtgacatggag
agcattttatttttattgtcgatacaagtagacgtaaactcgagaatacatgacgttacg
caaacgcctcccttacatcttgcagccgtttcggggaacgagatgttggtgcgaagtttg
attttggcgggtgctcgtgtcaacgatacagatgcaaataggaacaccgcgttgcacgtg
gcggcaaaagcgggacatgctactgtcgtctccgcattattgcaaaacaacattaacttt
gatgcggtaaacgcggacggcgataacgcgttgcacgtagctgtaagagagggtcacgta
tcagtagtacggacgttgttgactgagtgtacgctagatgcggaagcggtaaatctcaag
ggtcgcaaccctctacatgagctggccagatgtgcgagggataacgctgcgacgatatgc
gacctgtttttagaatgcatgtcacaatatccagttaataacgcagatttagatggaaat
acgccgttgttaattgcgtacatgaagggcaatggcaatctttgtagaacattagtgaaa
gctggagcgtgtctaggttcgatgaataaagatggaattacgatcttcaattatcaagta
gcgacgaaacagctattatatagactgttagattccctgacacaagaagcaccgtggtca
gacaaagattgctgcttagagtgcggaacaaaattctctctcacaatgcgcaagcatcac
tgccgacattgtggacgaattttgtgcagcaagtgttctggtcaagatgtaccaatcttg
aaattcggcttgaacaagccagtacgcgtgtgcaacgtgtgcttcgatgtattgttgggt
acaggttctcttcaaccgtcatacttggaggcaatgaacggcatggagaggcatggtcat
ggacatggacattcacatgcgcactcgcatcgtcatcgccattcccatggcagttctcaa
agtacttcgcagaactcgaatcagccgtcatcgaaacatagccacggacacgtgacacat
tcgcaaaaggatgcagccgcgccaccggcgaccccgaagacccagagaaattttaagttg
ctggttgatccatttttagttaagggagctacaagactatgcagatacgatggaactgtc
ccgggagacccgacgtatccacaagttcagcctcgagatcccagatcgcaattaacaagg
atctggactcgactcgaacagctcgatctacctgtacctagatttaaaatcgacgccaat
tactgtggagagccaccgccactggaagtaacattttgccatttaaacgacaatatcgat
aagatatttttgacaaacatggttcagaaatttgggtctatagaagagcttactatttat
tatcacccactaaccaataagcatcttggcatagcaagagtggtgtttgaatcgaccaag
gcatccaaggtgtgtgtagaaaagttgaataatacatctgtgatggggaaagtattaagg
gtgtttttagatccctttggggaagaatgcaagaagatgtttgaggaattaactattgag
aagaaaccagagaagaaggtggaaaaagaggttccaaagccaccaccaccggaggttgaa
caagagaaacatcagacaccagtagaaaaggctgtgcctgaagaaagggatgactttaga
aataataaaaaaactattctaagtatggacaagaatagagaaccatacgtagaaaattca
agatataacaaatacagagactatcctacgccgagcggcagcacaggtagtgatttgggt
tatggaacggcgcccagtgaattgaattattctagtaattactctcaaaattctaccccg
gcaacaaattatgatttctattatagcagttatcatcatcaacctccaagtagttactta
gctaatatcccacaaaatgtgtcacagagtataccgattcaacagaactcgaatgtatgg
tggggcaataattctggctcgacgggatattcaacttcgacctctgtttggccaattcaa
caacatgcgacaaatttagacagtgctggttctaatatgacaccaattaataataaaact
tccagtgcaaaggtgcatcatactcctaaaaaggaaaaagagaatcagactactacggca
aagagtacgccacgcgattctcccgatgaaactcgcaaaacattagatttagatacgaga
attgctatgttattaaaggataaagcaggtggaatggcacctccttttctacaatttggc
agtgactcggaagacgataaaaaatctcaacctgacaatgagatgctgtcagagcctccc
agtcccttcctctcgcgcgaaatatacaaacaatgtttcgacaagatagtagagaggaat
aaggaacgcaggaaaattcatgagaatagcattagtcatttctctgtggacgaggatttg
ggtagtgtcataagttccagtgaagatgaggcattgttgggaagttacagtcctgcacct
gatgacaatgaaccagagccacctaaggacccaccaccgcctccgccacctgacgacgac
agaatgtctctgagccctttgagttcaggggatgaaaaaattgaggaagtaatagcgcaa
actgaaccttcgaatcaactatatccggcagctggttatcctggacatttgactcattac
ccctctaatgatgtgtataattggccacgaccgacacagtatccttatccttatggaaca
acttatttacagagccattatcaacctaccacggcaactttttcagcaacaattggaaat
catcaaggagcaaactattattcttctttccaatctcggttacatgctatggcaaattat
aacatcacgaaagatccacagggacctgccattaatggagtattgaacaaagttgtaaat
gaactaaaacaaattctaaaaaaagattttaataagaaaatgatagaaaacacagcattt
aaattattcgaggtttggtgggacgaaaagaaatccgagaagaatcaaactcagggtagt
ggcgacaatatcattgccaataacacgacaaaagaggatgtgaaaccacaaggattgtct
tcattattggagcaagcgacgccgttaggactcaattacgatggtttcggtttgggtatt
cgagctagtatgccaaagatgccttcatttaggcgcaagatcaaagctccaagcccatta
ccgcaggatgaggatagtcggcagtcgggtcacgctgatatggaaacaattgaaagtgac
agtgatttggatgtaccacctgtacaaaaaacgaaaaaacctctgacttctcttccgact
gtctcatcctcgtctaccacgtcttcatcaatcgaaagtagtagcgaggaggttagttcc
agtgaatcttccgatagttcaaatgaaagttccgatgaagaagcttgtttcgaagatgag
caagatacagatagccgaatgtccgatcacagacctttggctagtaatagcgaggatcct
gatatattgatggaactcgcgatccaaaggtctctagactgtcccacgccaaccggcaga
gaaacgccagtgccggatatcaaaattaaagatcaaaattcgatcgagtttccacagatt
gatgatgataataatctggatagtttattagtttctcctgtagggtacgaaagcgtcaaa
gaagaggaaagaattgccgagaagatgcctgtagcggaagaaaaaccgtttgatgtgtat
aaaaccttggacaaggaaataaagaatgtgtcgagaatcaccgaagacaagggaacgcag
agtgatataaaacctgcaccaatgatgataacatcagcaataaaagaggaaacattacca
gatatggagaattcggccgcagaagctttgatgactttagctgggcaggataacattata
cgacataggagtcctggtcctgtacagcctaatattatcagagcgctgcagacaatgtca
gcaaaatatatcaatgatgaacctattttgaaggataagattgaaatgtttagcgagatt
cctacgactgactcggaggaagaaagcttagaaatcagaaggctaaggtatcaagcagag
acagaacttcgattaaatggacagcgaacaccgagttcacccggttctcaagcttcgcaa
gtatacatggaacattcatattcgttaccacccgcacaaccggagcctatcgaaccggtg
atacgtgtaccgccagcctcagtgaaagtaaaacattcgaagattgtcaaattaacaaaa
tcaaaagacaatactcataaaatcgagaaacagaaatccaagaaatatacaaaagtacat
agcagtcatcagaaccatgtgggagaaaaggagaatatccgaaatgagtacatatacgac
aagcttcctaagcaggttccagagccgaccgtcacgtacaaagcacgagattatatgtca
gaaatggctattttgtacgaatttttaactagaggaatagacgcagaggatgtggagtat
ttgagaagaagttaccaggctttcttagcggacgatagtcacagttactggttgaacgac
acacattgggtcgatcatccgccgacggatgtaccgagtcccgcgaaaaagaggaaacga
gacgaactacgattgcacgcgagtggaagtgctagaacggaaggatattacaaagttgac
atcagagagaaggctaaacataaacatcattatgctcaaagtatacagcgtagcaatgat
gtggaggacagtggtggctcttatattggaggtgatggtgtaatgaatggtccaaagaat
agttctaaagcgttgaccggtaagatgcaagcgttgtcacgcgaagcacgcagtaatcaa
cgtcggttgttaacagctttcggaattgatacggacagtgatctccttaagtttaatcaa
ttaaagttccgtaaaaaacaattgaaatttgctaaatctggtattcacgattggggctta
tttgccatggaaccaatcgcggccgatgaaatggttattgagtatgttggacaaatggtt
agaccggttgtagccgatctacgggaagcccaatatgaagctactggaatcggtagttct
tacctcttccgcatcgatttagatacaattatcgatgcgacaaagtgcggcaatttggcg
aggttcattaatcacagttgcaatccgaattgttacgcaaaagtgatcacgattgaaagc
caaaagaagatcgtaatctacagtaaacaaccaataggagttaacgaagaaattacttat
gattataaatttccattggaggatgataaaatcccttgcctttgtggagctcctcaatgc
cggggtaccctcaactga

DBGET integrated database retrieval system