KEGG   Sodalis praecaptivus: Sant_0355Help
Entry
Sant_0355         CDS       T03004                                 

Gene name
glpD
Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sod  Sodalis praecaptivus
Pathway
sod00564  Glycerophospholipid metabolism
sod01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sod00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Sant_0355 (glpD)
Enzymes [BR:sod01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Sant_0355 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 FAD_oxidored 3HCDH_N Pyr_redox_2 FAD_binding_2 Lycopene_cycl GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: AHF75460
UniProt: W0HTD1
LinkDB All DBs
Position
complement(401730..403238)
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGTGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRLGLFMYDHLGKRTSLPAS
EGVRFGADSVLKPEIVRGFEYSDCWVDDARLVVLNAQEVVARGGDVKTRTQVTRAWRENG
LWHVEARDSLTGKSQRWQAKGLANATGPWVKHFIDDSLHLPSQYGIRLIKGSHIVVPRVH
SQPQAYILQNEDHRIVFVIPWMETFSIIGTTDVEYHGDPGEVHIDDGEIDYLLKVYNAHF
KRPLGREDIVWTYSGVRPLCDDESDSPQAVTRDYTLSLSDEDGKAPLLSVFGGKLTTYRK
LAEHALEKLAHYYPHAKGAWTRNAVLPGGDFVGTRDDYAAVLRRKFSFLPEALARRYSRT
YGTRSEQLLAGAAGLADLGEDFGHGLYEAELRYLVAQEWVVTLDDAIWRRTKLGMWLDEA
QQARIVDWLAQHVSPARLSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacttgatcgtcatcggcggcgggatcaacggtaccggcatcgctgcc
gacgccgccgggcgtggactgtccgtattgctgttggaagcgcaggatttggcgtgcgcc
acgtcgtccgccagctccaaactcattcacggtggcctgcgctatctcgaacattatgaa
tttcgtttggtgagcgaagcgctggccgaacgggaggtgctgttaaaaatggcgccccat
attgccttcccgatgcgctttcgattgccgcaccggccgcacctgcgcccggcgtggatg
atccgcttgggcctgtttatgtatgatcatctgggcaaacgcaccagtctgccggcaagt
gagggcgttcgatttggcgcggattcggtcctgaaaccggaaatcgtgcgcggtttcgag
tattcagactgttgggtggacgatgcgcgtctggtggtgctcaacgctcaggaagtggtg
gcgcggggcggcgatgtcaaaacccgtacgcaggtgacccgcgcctggcgggaaaacggt
ctgtggcacgtcgaggcgcgcgatagcctgaccggcaagagccaacgctggcaggccaag
gggctggccaacgccaccggcccttgggtgaaacatttcatcgatgacagcctgcattta
ccgtcgcagtacggcatccgcctgataaaaggcagccatatcgtggtgccgcgggtccat
tcccagccgcaggcgtacattctgcaaaacgaagatcaccgcattgtgttcgtcattccc
tggatggaaacgttctcgattatcggcaccaccgacgtggaatatcatggcgatccgggg
gaggtgcatatcgatgacggtgaaattgactatctgctcaaggtttataacgcccatttc
aaacggcccctgggccgcgaggacatcgtctggacctactccggcgtgcgcccgctgtgc
gacgacgaatccgattcgccgcaggcggtgactcgcgactatacgctatcgttaagcgat
gaagacggtaaagcgccgctgctgtcggtatttggcggcaaactcaccacttaccgcaag
ctggccgaacatgcgctggaaaaactggctcactactatccccacgccaaaggcgcctgg
acccgcaacgcggtgctgccgggcggcgatttcgtcggtactcgcgacgactatgccgcc
gtgctgcgccgcaaattctcctttctgccggaagcgctggcgcggcgctacagccgcact
tacggcacccgcagcgagcagctgctggcgggcgccgccggcctggcggatctgggtgaa
gatttcggtcacggcctgtacgaagccgagctgcgctatctggtagcgcaggagtgggta
gtcacgctggacgacgccatatggcgccgcaccaaactgggcatgtggctggacgaggcc
cagcaggcgcgtattgtcgactggctggcgcagcacgtcagtccggcgcggctgtcgctg
gcgtcctaa

DBGET integrated database retrieval system