KEGG   Sodalis praecaptivus: Sant_2163Help
Entry
Sant_2163         CDS       T03004                                 

Definition
(GenBank) Putative hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
sod  Sodalis praecaptivus
Brite
KEGG Orthology (KO) [BR:sod00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Sant_2163
Enzymes [BR:sod01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     Sant_2163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AHF77210
UniProt: W0HYC4
LinkDB All DBs
Position
2489165..2489983
Genome map
AA seq 272 aa AA seqDB search
MKVALGQFSVAREWQANLRTCIDLMQQAQAGGADLLVLPEAVMAQDSADPTLSVKVAQPL
DGPFVSALLTASRAFAMTTILGLHVPAPAGKASNVVIALRDGAIVARYHKLHLYDAFAMQ
ESRNIQAGDTVPPLFAVAGMTVGLMTCYDIRFPELAGRLALDGADVLVLPSAWVRGPLKE
RHWEVLVTARALDNTCYLVAVGECGPRNIGQSLVVDPLGVAIAKAAETPALIFAHLDPAR
VQQARQALPVLANRRFARPELAPPAARDLKRQ
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgctttaggccagtttagcgtggcccgtgaatggcaggccaatctgcgcacc
tgcattgacttgatgcaacaggcgcaggccggcggcgcggatttattggtgttgccggaa
gcggtgatggcgcaggacagtgccgatcccacgttatcggtaaaagtcgcccagccgctg
gacggtccgtttgtcagcgccctgttgaccgccagccgcgcctttgcgatgacaaccata
ctgggtctccacgttcccgcgccggcggggaaagccagcaatgtcgtgatcgcgctgcgc
gacggcgccatcgtcgcgcgctatcacaaactgcatctgtatgacgccttcgccatgcag
gagtcacgcaacattcaggcgggcgacacggtgcccccgcttttcgcggtggcgggtatg
acggtgggtctgatgacctgctacgatatccgctttccagaactggcaggccgcctggcg
ctggacggcgccgacgttctggtcctgccttccgcctgggtgagagggccgctgaaggag
cggcactgggaggtgctggtgaccgcccgcgcgctggacaacacctgctatctggtggcg
gtgggggaatgcggaccgcgcaacatcggtcagagcttggtggtggatccgctcggggtc
gcgatcgccaaagcggcggaaacaccggcgctgattttcgcccatctcgatcccgcccgc
gtgcagcaggcccggcaggcgctgcccgtattggccaatcgccggtttgcgcggccggag
ctggcgccgcccgcagctcgggacctaaaacggcagtga

DBGET integrated database retrieval system