KEGG   Sodalis praecaptivus: Sant_2268Help
Entry
Sant_2268         CDS       T03004                                 

Definition
(GenBank) Alkyl hydroperoxide reductase subunit, FAD/NAD(P)-binding protein
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sod  Sodalis praecaptivus
Brite
KEGG Orthology (KO) [BR:sod00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Sant_2268
Enzymes [BR:sod01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Sant_2268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like Glutaredoxin Thi4 FAD_binding_3 DAO K_oxygenase NAD_binding_8 AlaDh_PNT_C FMO-like
Motif
Other DBs
NCBI-ProteinID: AHF77313
UniProt: W0HYT0
LinkDB All DBs
Position
2612272..2613840
Genome map
AA seq 522 aa AA seqDB search
MLDTTMKTQLKAYLEKLTKPVELVATLDEGAKSAEIRGLLTDIADLSDKVSWREDNQLPV
RKPSFRVANPGVDHGPRFAGSPLGHEFTSLVLALLQTGGHPSREAQSLLDQIRQLDGEFH
FETYYSLTCHNCPDVVQALNLMAILNPRIHHTAIDGGAFQNEIQERNIMGVPAVFMNGES
FGQGRMTLSEIVNKIDTGAAARAAQALNQREVYDVLIVGSGPAGAAAAVYSARKGIRTGL
LGERFGGQVLDTVDIENYISVPKTEGARLATSLKAHVDEYDVDVIDVQSASRLIPAAAPG
QPHQIETASGARLTARSLIIATGARWRNMNVPGEELYRTRGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGLVEHVTLLEFAPAMRADAVLQAKLRSLNNVDILLNAQTLEVTGD
GTKLTGLRYKDRVSHGEHELAVAGIFVQIGLLPNTQWLEGTVERNQTGEILIDAKCETSV
KGIFAAGDCTSVPYKQIIIAAGEGAKASLSAFDYLIRNTPVV
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacactacgatgaaaacccaactcaaagcctaccttgagaaattgaccaaaccg
gttgagttagttgccacactggatgagggcgccaaatccgccgaaatccgcgggctgctg
acggatatcgccgacttgtcggacaaggtgagctggcgggaagataatcagctgccggta
cgcaagccctctttccgggtggcgaatcccggcgtggatcacgggccgcgctttgccggt
tcaccgctgggccatgaattcacctcgctggtgttggcgctgctgcaaaccggcggacac
ccctcccgggaagcgcagtcgctgctggatcagattcgccagctcgacggcgagttccat
tttgaaacctattactccctgacctgccacaattgcccggacgtggtgcaggccctgaac
ctaatggcgatactgaatccgcgcattcaccatacggcgattgacggcggcgcgttccaa
aacgagattcaggaacgcaacatcatgggcgtgccggccgtgttcatgaacggcgaatcg
ttcggccagggacgcatgacgttgagtgaaatcgtcaacaagattgataccggcgcggcg
gcccgtgcggcgcaggcgcttaatcagcgcgaggtgtatgacgtgctgatcgtcggcagc
ggtcctgccggcgcggcggcggcggtctattccgcccgtaaagggatccgtaccggtctg
ctgggcgaacgctttggcggtcaggtactggataccgtcgatatcgaaaactacatttcg
gtgcccaaaaccgaaggcgccagactggccacgtcgctgaaagcccacgtggatgagtat
gatgtcgacgtcattgatgtgcaaagcgccagcaggctcattcccgccgccgcgccgggc
cagccgcatcagattgaaaccgcctccggggcgcgcctgacggcccgcagcctcattatc
gccaccggcgcgcgctggcggaatatgaacgtgccgggcgaggagctttatcgtacccgc
ggcgtgacctactgcccgcactgcgacggtccactgttcaagggcaagcgggtggcggtc
atcggcggcggcaactccggcgtggaagcggccatcgacttggctggcctggtggaacat
gtcaccttgctggaatttgcgccggccatgcgcgccgacgccgtgctgcaggcgaaatta
cgtagtctgaacaacgtcgatattttgctcaacgcccagacgctggaagtgacgggcgac
ggcaccaagctcaccggcctgcgctataaagatcgtgtcagccacggtgaacatgagctg
gccgtcgcgggtatttttgtgcaaatcggcctactgcccaacacccagtggctggaggga
acggtggaacgcaatcagacgggcgaaatccttattgacgccaaatgtgaaaccagcgtg
aaaggcatttttgccgccggcgactgcactagcgtgccctacaagcagataatcattgcg
gccggcgaaggcgccaaagcctcattgagcgccttcgattacctgatccgcaatacgccg
gtggtgtaa

DBGET integrated database retrieval system