KEGG   Spinacia oleracea (spinach): 110782125Help
Entry
110782125         CDS       T05137                                 

Definition
(RefSeq) uncharacterized protein LOC110782125
  KO
K10801  methyl-CpG-binding domain protein 4 [EC:3.2.2.-]
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:soe00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    110782125
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:soe03036]
    110782125
   03400 DNA repair and recombination proteins [BR:soe03400]
    110782125
Enzymes [BR:soe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     110782125
Chromosome and associated proteins [BR:soe03036]
 Eukaryotic type
  Heterochromatin formation proteins
   MBPs (metylated DNA binding proteins)
    110782125
DNA repair and recombination proteins [BR:soe03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     110782125
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HhH-GPD
Motif
Other DBs
NCBI-GeneID: 110782125
NCBI-ProteinID: XP_021841914
LinkDB All DBs
Position
Unknown
AA seq 1046 aa AA seqDB search
MQINAESIQRNAQSIRISTPCKTQSSISMAADRPLKRQRQNKVLPDNLIKVNYTKTSPVI
VLALNASSNYALETRKLAKNRSKNGGSIRAKKRNVDKGKLVDDNCINVVECVSPYFSNKG
KRKGDVGEDLGGQGKRIDVRRENFVLVNRGNDGYETLLGFERHAEVSDVMVKDKEKDRVL
EGNQGGRETHVVVMNDDETRVVSPFFVKSGSVGKEKRKRKKKVCGEIQNAGRIVVEKRGI
DGIYHRIEENEVDMAERNSCTGSLLDLRRRAGVSDMVVKHEEKYDVLEGKRGEREAPVSM
TNDYEKTVVSPYFVKGGDGKEKEKKRRRKKSERYDQLWGKIVNVEKRENCGDISGRETSE
QHVEDHWNSLREVLLVFQQKADVPDVVVKHEDRHEDFEEEKSGREFSAGLMNENANENEN
ENENENEKRAVSPYFVKNNSKEKKQKQKRERKTHSDQSCGKIENVVKLVLEKKEIDCDPY
DKEKNEQHFEDTNSPRGRVSLDLQRRVDSPYMVVKHEEKHEDLEEKERGRDLLESKMNDE
EKRVAFPCIVKCDSKGEKTRKRKKKVQNDQPCGENETEAFNVMSPKVVSPYFVRKGGHGH
ENSKFECMKETEKKVRKPRNNKKRICEDSKELETEKEVKKQRKSKKKGTFVDQCCAKQSN
TDKNLGLGLQSVVSAGVRMKMDSEAAHERGLKRIVVTLESASRQDLINQGNCTAKVDEEE
PLHFLKINTSLNGQTLHGDQDDCDLMTSSINGKEKKKKKKKTVSPMCGSAAGLDPSSLSS
SKEDLVHDNQHCPKASVTKVVSPYFENSLRENECDNGRDKADCKYQKKRRVDRTKYIKFE
EVLSNYAYKGDNYLNKEEENGGKKEEDGSAGKGKKKGKKQQNGTLSAAEKRADAYQRKAP
DCTWRPPLSPYNLLQEEHAHDPWRVLVTCMLLNITTGPQVKQVLSLFFNVCPNAEAAVNA
DNIRIASVIQSLGLHRKRATMIQQFSREYLSDDWTHVTQLHGIGKYAADAYAIFCTGKWR
QVTPTDHMLNYYWKFLQNRGLKEVAF
NT seq 3141 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcaatgctgaatcaattcaaagaaacgctcaaagcatcagaatttcgacacct
tgcaaaactcaatcttcaatttcaatggcggctgatcgtcctctgaagcggcaacgtcaa
aataaggtattgcctgataatcttattaaggttaattatactaaaacttctccagttatc
gtattagcattaaatgcatcatctaattatgcactggaaactagaaaattagcgaaaaat
cgaagtaaaaatggtggtagtattagggcgaagaagcgtaatgttgataaagggaaactg
gttgatgataattgcatcaatgttgttgaatgtgtttctccttattttagcaacaaaggg
aagaggaagggtgatgtgggagaagatttggggggtcagggtaagagaattgacgtgagg
agagagaattttgtgttggtgaataggggaaatgatgggtatgagacattgttgggtttt
gaacgacatgctgaagtttctgatgtgatggttaaagacaaggagaaggatagggtttta
gagggaaatcaagggggaagggagactcatgttgttgtgatgaatgacgacgagacgaga
gtcgtttctcccttttttgtcaagagtggaagtgtggggaaggagaaaaggaaaaggaag
aagaaagtatgtggcgaaattcagaatgcagggagaattgtggtggagaagagggggatt
gacgggatttatcatcgtatcgaggaaaacgaggtggatatggcggagagaaattcatgt
acagggtcgttgttggatcttcgaaggagagccggtgtttctgacatggtggttaaacat
gaggagaagtatgacgtccttgaggggaagagaggggaaagggaagctcctgttagtatg
acgaatgactatgagaagacagttgtttccccatattttgtgaaaggtggcgatggcaag
gagaaagagaagaaaaggagaaggaagaaatcagaacgatatgatcaattgtggggaaag
attgtgaatgtggagaagagggaaaactgtggcgatatttctgggagggagacgagtgag
caacatgttgaggatcactggaattcactaagggaggtgttgttggtttttcagcaaaaa
gctgatgttcctgatgtggtggttaaacacgaggatagacatgaagattttgaggaggag
aaaagtgggagggagttttctgctggtttgatgaatgagaatgcgaatgagaatgagaat
gagaatgagaatgagaatgagaagagagctgtttctccatatttcgtgaagaataacagc
aaggagaagaagcaaaaacagaaaagggaaagaaaaacgcatagtgatcagtcgtgtggc
aaaattgagaatgtggtgaaacttgtgttggaaaagaaggaaattgattgcgatccttat
gataaggagaaaaatgagcagcattttgaggacacgaattcaccaagaggtagggtgtca
ttggatcttcaaagaagagttgatagtccttatatggtggtgaaacacgaggaaaagcat
gaagaccttgaggagaaggaaagaggaagggatctccttgaaagtaagatgaatgatgaa
gagaagagggttgcttttccgtgtatagtgaagtgtgacagcaagggggagaaaacaagg
aaaaggaagaaaaaagttcaaaatgatcaaccatgtggtgaaaacgagactgaggccttc
aatgtcatgtcaccaaaagtcgtttcaccatatttcgtgagaaagggaggtcatggccat
gaaaactcaaaatttgaatgcatgaaggaaaccgagaagaaagtaaggaagccgagaaat
aacaagaagagaatttgtgaggatagtaaggagttggaaacagaaaaggaagttaaaaag
cagaggaagagcaagaaaaaaggaacatttgttgaccaatgttgtgcaaagcagagtaat
acagacaagaacttaggattagggctccaaagtgttgtttctgctggtgtcagaatgaag
atggatagtgaagcagcacatgagaggggtttgaaaagaattgtggttactttagagtct
gctagccgtcaggacttgatcaatcagggaaactgcacagctaaggttgacgaggaggaa
cctttgcactttttgaagatcaacacgagtctgaatggtcagactttacatggtgatcaa
gatgattgtgacttgatgactagcagcatcaacggaaaggaaaaaaagaagaagaaaaag
aaaaccgtgtctccaatgtgtggctcagcagctggccttgatccctcatcattgagttcc
agtaaagaagatttagtgcatgataaccaacactgtccgaaagcttcagtgaccaaggta
gtctctccatactttgaaaattcattgagggaaaatgagtgtgataacggaagagataag
gctgactgtaaatatcaaaaaaagagaagggttgacaggactaagtacattaagtttgaa
gaggtactttccaattatgcttacaaaggggacaactacttgaataaggaagaggaaaat
gggggtaagaaagaagaagatggtagtgctggaaaaggtaagaagaaaggtaagaagcag
caaaacggtactctaagtgctgccgagaagcgagctgatgcttaccaaagaaaagcacca
gactgtacctggaggccacccttgtctccttacaatcttctgcaagaggagcatgcccat
gacccctggagagttttggtgacttgtatgcttctgaatatcactactggaccccaggtc
aagcaagtattgtcgcttttttttaatgtgtgccccaatgctgaagctgctgttaatgct
gataacatcagaattgctagtgtgatacaaagtttagggttgcatagaaaaagggcaaca
atgattcagcaattttctagggagtatttatctgacgactggacacacgtgactcagctg
catgggattggaaagtatgcagctgatgcttacgcaattttttgtacgggtaagtggcgg
caggtaaccccaacagatcatatgctgaattattattggaaatttctccaaaatcgtggt
ctcaaggaggttgctttttaa

DBGET integrated database retrieval system