KEGG   Spinacia oleracea (spinach): 110782932Help
Entry
110782932         CDS       T05137                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial-like isoform X1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe00010  Glycolysis / Gluconeogenesis
soe00053  Ascorbate and aldarate metabolism
soe00071  Fatty acid degradation
soe00280  Valine, leucine and isoleucine degradation
soe00310  Lysine degradation
soe00330  Arginine and proline metabolism
soe00340  Histidine metabolism
soe00380  Tryptophan metabolism
soe00410  beta-Alanine metabolism
soe00561  Glycerolipid metabolism
soe00620  Pyruvate metabolism
soe00903  Limonene and pinene degradation
soe01100  Metabolic pathways
soe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:soe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110782932
   00053 Ascorbate and aldarate metabolism
    110782932
   00620 Pyruvate metabolism
    110782932
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110782932
   00561 Glycerolipid metabolism
    110782932
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    110782932
   00310 Lysine degradation
    110782932
   00330 Arginine and proline metabolism
    110782932
   00340 Histidine metabolism
    110782932
   00380 Tryptophan metabolism
    110782932
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110782932
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    110782932
Enzymes [BR:soe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     110782932
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-GeneID: 110782932
NCBI-ProteinID: XP_021842900
LinkDB All DBs
Position
Unknown
AA seq 535 aa AA seqDB search
MASRRISSLLSRSLSTYLTSPVVGRTSCVRRGLQRYSTASAIDEPITPPVDINYTKLLIN
GKFVDAASGKTFHTVDPRTGKVIADVAEGDSEDVNRAVSAARKAFDEGPWPKMTAYERSR
ILLKFADLIEKHNDAIAALETWDNGKPYEQAAQIEVPMVARLFRYYAGWADKIHGLTVPA
DGPYHIQTLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTVVIKTAEQTPLSALYVAN
LCHEAGIPPGVLNVISGYGPTAGAALCSHMDVDKLAFTGSTSTGKLVLELAAKSNLKPVT
LELGGKSPFIICEDADIDQAVETAHFALFFNQGQCCCAGSRTFVHESIYDEFVAKAKARA
ANRSVGDPFKQGIEQGPQIDPEQFNKILGYIKSGINSGATLETGGDKMGSKGYYIQPTVF
SNVTDDMLIAKDEIFGPVQTILKFKSIEEVIRRANASDYGLAAGVFTQNIDTANTLSRAL
KAGTVWINCYDIFDAGIPFGGYKMSGIGREKGEYSLRNYLQVKAVVTALKNPAWL
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcagaaggatttcttctctcttatctcgctcactttcaacttatctcacctct
cctgttgtagggaggacttcttgtgtcagaaggggacttcaaagatacagcactgcttct
gctatagatgaaccaatcaccccacctgtggatataaattatacaaagcttctgattaat
ggcaaatttgtcgatgcagcatcagggaaaacatttcacacagtggaccctcggactggg
aaggtgatagctgatgttgctgaaggagattccgaagatgtgaacagagcagtctctgct
gctaggaaggcgtttgatgaaggaccatggccaaagatgactgcttacgaaaggtcaaga
attcttttgaaatttgccgatcttattgaaaagcataatgatgcaattgctgctttagaa
acatgggataacggaaagccctatgagcaagctgcccaaattgaagtaccaatggttgca
cgccttttccggtactatgctggttgggcggataagatacacggcctcactgttcctgct
gatggaccatatcatatacagactctgcatgaaccaattggtgtagcagggcagattatt
ccatggaactttccccttctaatgtttgcttggaaagttggacctgcattagcatgtggt
aacacagttgttatcaagacagcagaacagactcctttgtcagccctttatgttgccaat
ttatgtcacgaggccggaattcctccaggagttctaaatgtgatttcaggttatggccca
actgctggtgcagctctctgctctcacatggatgtggacaagcttgcttttactggatca
acaagcaccggaaagctagttcttgaattagcagcaaagagtaatctcaaacctgtgact
ttggagcttggtgggaaatctccatttataatatgtgaagatgcagatatagaccaagca
gtggagaccgctcattttgctctatttttcaatcagggacaatgttgttgtgctgggtcc
cgtacatttgtccatgaaagtatatacgatgagttcgtagctaaagcaaaggcgcgagct
gcaaaccgatccgttggagatccatttaagcagggcattgaacaaggtcctcagattgat
cctgagcagtttaataagattctggggtacataaaatctggtatcaatagtggagcaaca
ctggaaaccgggggggacaaaatgggctcaaagggctactatattcagcccacagttttc
tcgaatgtaacggatgacatgctgatagcaaaagatgaaattttcggtccggtgcaaact
atcttgaaattcaagagcatagaggaggtgatacgtcgagcaaatgcatctgattatggt
ctagcagctggagttttcactcagaacattgatactgctaatactttatcacgcgctctt
aaagctggtacggtgtggataaactgttacgacatttttgatgctggaatccctttcggt
ggttacaaaatgagcggcattggtagagagaagggagaatacagcttgagaaactacttg
caagtgaaggccgttgtgactgcgttgaagaatccagcctggttatag

DBGET integrated database retrieval system