KEGG   Spinacia oleracea (spinach): 110784088Help
Entry
110784088         CDS       T05137                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe00052  Galactose metabolism
soe00500  Starch and sucrose metabolism
soe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:soe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    110784088
   00500 Starch and sucrose metabolism
    110784088
Enzymes [BR:soe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     110784088
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 110784088
NCBI-ProteinID: XP_021844185
LinkDB All DBs
Position
Unknown
AA seq 903 aa AA seqDB search
MKKKIPSLALGILLVFLLQYLVAGISTSENDPEGVIGYGYKVKSVKVDSGTRRSLTALLQ
LVKNSSVYGPDIQLLSITASLESNDRLRVRITDAKHRRWEIPDNILHRHQPPPPPPHSLS
SLYRTLLSSPTTNRRKILLSHPNSDLTFSLINTTPFGFTISRKSTHDVLFDATPDPTNPN
TFLIFKDQYLHLTSSLPGTRAHIYGLGEHSKPTFQLAHNQTLTMWAADIPSSNPDVNLYG
SHPFYMDVRSSPVAGSTHGVLLLNSNGMDVEYTGNRITYKVIGGIIDLYFFAGPSPAQVV
EQFTRVIGRPAPMPYWAFGFQQCRYGYHDVYELQSVVAGYAKAKIPLEVMWTDIDYMDAY
KDFTLDPVNFPLDKMKKFVNNLHKNGQKYVVILDPGISTNKTYETYIRGMKHDVFLKRNG
KPYLGSVWPGPVYFPDFLKPSALTFWTDEIKRFLNLLPVDGLWIDMNEISNFISSPPIPG
STLDNPPYKINNSGVMLPIINKTIPPTAMHYGDIPEYNVHNLFGYLEARVTRAALIKLTK
KRPFVLSRSTFSGSGKYTAHWTGDNAATWNDLVYSIPSMLDFGLFGIPMVGADICGFLGN
TTEELCRRWIQLGAFYPFSRDHSSLGTTYQELYRWESVAASARKVLGLRYTLLPYFYTLM
YEAQLNGIPIARPLFFSFPDDIKTYGISSQFLLGKGVMVSPVLKPGVVSVTAYFPRGNWF
DLFDYTRSVTASTGRYVTLSAPPDHINVHIQEGNILAMQGKAMTTQAARKTPFHLLVVMS
DCGASFGELFLDDGVEVTMGVNRGKWTFVKFIAASAKQTCIITSDVVSGEFAVSQKWVID
KVTILGLRKGTKINGYTVQTGAVTRKGDKSKLKSTPDRKGEFIVAEISGLNLLLGREFKL
VLH
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagaaaatcccatctttggcactgggaatactactagtatttctactacaatat
ttggttgccggaatatcaacatcggaaaacgacccggaaggggtaatcgggtacgggtat
aaggtgaaaagtgtcaaagttgactccggcacgcgtcgatcgttgaccgcattgcttcag
cttgtgaagaattcctcagtttatggacctgatattcaactcctctccattactgccagc
ttggaatctaacgaccggctcagagtccgaattaccgacgccaagcaccgccgatgggaa
atccccgacaatatccttcaccgccatcaaccaccaccaccaccgccccattctctctcc
tccctctaccgcaccctcctctcatctcccactaccaaccgccgcaaaatcctcctctcc
cacccaaactccgacctcactttctctctcatcaacaccacccccttcggcttcaccatc
tcccgcaaatccactcatgacgtcctcttcgacgccacccctgaccccactaaccccaac
accttcctcatcttcaaagaccagtacctccacctcacctcctccctcccgggcacccgg
gcccacatctatgggctcggggaacactccaaacccacttttcagctcgcccataaccaa
acccttactatgtgggctgccgacattcctagcagcaacccggatgttaacctatacggg
tcccacccgttttacatggatgttcgttcttcgccggtggcggggtccactcatggggtg
ttgctgttaaatagcaatgggatggatgttgagtatactggtaatcggattacttacaag
gtgattgggggtattattgacctttacttctttgccggaccttcgccggcacaagtggtg
gagcagtttactcgggtcatcggccgccctgccccgatgccttattgggcatttggtttt
cagcagtgccgttatggttatcatgatgtatacgagcttcagtctgtggtagctgggtat
gcaaaagctaagattcccttggaagtaatgtggacagatattgattacatggatgcttat
aaagatttcactcttgaccctgttaattttccactggacaagatgaagaaatttgttaac
aaccttcacaagaatgggcaaaaatatgtggtaattctggatcctggtatcagtacaaat
aagacgtatgaaacatacattaggggaatgaaacacgatgtctttctgaagcgtaatggt
aaaccataccttggttctgtctggcctggtcctgtatacttccctgattttctgaagcct
tctgctttgaccttttggactgatgaaatcaagagatttctaaatctcctccctgttgat
ggtctttggattgacatgaacgaaatatcgaactttatttcttctccacctatccctgga
tctacacttgataatcctccttataaaatcaataattctggagtgatgttacccattata
aacaagactatcccaccaaccgccatgcactatggtgatattcccgaatacaatgttcat
aacttatttggataccttgaagctagagtcactcgtgctgcccttattaaactcaccaag
aaaaggccattcgtactctctagatcaacgtttagtggttcggggaagtacactgcacat
tggacaggagataatgctgcaacttggaacgatcttgtgtactcaattccgtctatgtta
gactttggactttttggtattccgatggtcggggcagatatttgtggttttcttgggaac
acaactgaagagctatgtcggcgttggatacagctgggggctttttatcctttctctaga
gatcattcatcacttggtacaacctatcaagagctgtacagatgggaatcagtcgctgca
tcggctaggaaagtcttgggactccgctacacgcttctcccttacttctatacattgatg
tacgaggcacagctgaacggaatccctatagcacggcctcttttcttttcttttcctgat
gacatcaaaacttatggtatcagctcacagtttcttcttggtaaaggtgtaatggtctca
cctgtcctgaaacctggtgtagtatctgtcactgcttactttccacgtggaaactggttc
gatctgttcgattatactcgttcagtcactgcctctactggaagatatgttactcttagt
gcaccccctgatcatatcaacgttcacattcaagaaggtaatattctggctatgcaaggg
aaagctatgacaacccaagcagcacgcaagacaccgttccatctattagtggtgatgagc
gattgtggggccagcttcggtgagttgttcttggatgatggggttgaggtgacaatggga
gtcaatagaggaaaatggacttttgtgaaattcattgctgcatcagcaaaacagacttgt
attatcacctcagatgtagtttctggggaatttgcagtgagtcagaaatgggtcattgac
aaggttacaattctgggtttgagaaaaggaacaaagatcaacgggtatacagtacaaaca
ggtgctgtaacaagaaaaggcgataaatccaaacttaaatcaactccagatagaaaagga
gagttcattgtagctgagatttctggtttgaacctgcttttaggacgcgagtttaagctt
gtattacactga

DBGET integrated database retrieval system