KEGG   Spinacia oleracea (spinach): 110784817Help
Entry
110784817         CDS       T05137                                 

Definition
(RefSeq) protein SET DOMAIN GROUP 41 isoform X1
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe00310  Lysine degradation
soe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:soe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    110784817
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:soe03036]
    110784817
Enzymes [BR:soe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     110784817
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     110784817
Chromosome and associated proteins [BR:soe03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     110784817
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF2769
Motif
Other DBs
NCBI-GeneID: 110784817
NCBI-ProteinID: XP_021844955
LinkDB All DBs
Position
Unknown
AA seq 640 aa AA seqDB search
MEMRAKEDIQIGQDITPPLAPLAFSLYNSSLPSNCSACFLSLSTATTAAATFLRYCSNGG
CSSTHDSSLHYSSAEHHLFSLLHSNPSLFPHPDSSDLRLSLRLLHLLPSYTLSPRFLGLL
TNRHEFISDEVDSARVRTGASLMAMARAMRDEREFEFESNSDGNGGDCELEKAVLCLVIT
NAVEINFNSQRLGIGVYDKCFSWINHSCSPNSCYRFVPAFAVSEGSDDSSSIWILPFGDA
AKMQMEDRGGCTTCELAKGFGNYGPRLIVRSIKGIQRGEEVTITYTELLQPMALRQSDLL
LEYKFFCNCSRCSTVPQDYVDHALEEMFCVNLHKGCSKTLDKHYKEKAVEMLRDMLDSSI
EEYMEVGDPVSCCDKVEGLLTEGLSNRHLEQARGDSDIDIKLSPLHYISLNAYTTLISTY
KIRAGLNGEMHPQSFDMSRTSVAYSLLLACATHYLFLSDPSLIVSAATFWIDAGQDLLSF
GRSPSWNSFANGELQNLSAVPHVNCPRCSLLDRFESHLSCTQTRNMIFNSITKEFHKCTS
IIIPKAWSFLVEGCKYLKDVKDPIDFSWIQGHENTQLQHGEFNICNGSENADLSENESID
DVKTAIYELGMHCLLYGGFLSSICYGDSCSTRLIRNVICI
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgagagcaaaggaagacatacaaataggacaagacataactccaccactagca
cctcttgcattctctctctacaactcttctctcccctccaactgctccgcctgcttcctt
tctctctccactgccacaactgccgccgccaccttccttcgctactgctctaatggcggc
tgctcctccacccatgattcttccctccattactcctccgcggagcaccacctcttttct
cttctccactctaacccttctctcttccctcaccctgactcctccgacctccgtctttct
ctccgcctcctccacctcctcccttcttacactctctctcctcgcttccttggtctcctc
accaatcgacacgagtttatttccgatgaggttgattcagctagggttaggactggcgca
agcctgatggccatggcgcgagcgatgcgggatgagagagaattcgagttcgaatccaat
tccgacggtaatggtggtgattgtgagttggagaaggccgtgttgtgcttggtgattacg
aatgctgttgaaatcaattttaatagtcagaggctaggaattggggtttatgataaatgc
ttctcttggattaatcatagctgctctcctaattcgtgttaccgttttgttcctgcgttt
gctgtttcagagggttccgatgattcgtcctcgatatggattttgcctttcggtgatgca
gctaaaatgcaaatggaggatagaggtggttgtactacttgtgagttggcaaaaggattt
ggcaactatggtccaagactcattgttagaagcatcaagggaattcaaagaggggaagag
gtgacaattacatataccgaattgttgcagcctatggcactgaggcaatcagatttgttg
ctggagtataagttcttctgtaattgtagtcggtgtagcacagtgcctcaagattatgtt
gatcatgctctggaggaaatgttttgtgtcaacctccacaaaggttgctcaaaaactctg
gacaagcattataaggaaaaagcggttgaaatgttgagggatatgttggatagcagtata
gaggagtatatggaggtaggcgatcctgtctcatgttgtgacaaggttgaaggactcctc
actgaaggcctgtcaaatagacatctggagcaagcgagaggagattctgatatagatatt
aagttgtcacccctgcactatatctctttaaatgcctatactacgttgatttctacatat
aagatccgtgctggtttgaatggcgaaatgcatccccagagctttgatatgagcagaact
agtgtagcatacagcttgctgcttgcttgcgcgacacactatctctttctctcggatcca
tctttaattgtttctgctgcgacattctggatagatgctggacaggacttactatctttt
ggaagaagtccgtcatggaattcttttgcaaatggtgagttgcaaaatctttcagctgtt
ccccatgtcaattgccctaggtgttccttgttggatagatttgaatctcacttgagttgt
actcaaactcgaaatatgattttcaacagtataaccaaggaatttcacaaatgtacatca
attatcattccaaaggcttggagcttcttggttgaaggttgtaaatacttaaaagatgta
aaagatccgattgatttcagctggattcaaggtcatgagaatactcagttgcagcatggt
gaattcaacatatgcaatggtagtgagaatgcagatcttagtgaaaatgagtccattgat
gatgtaaagacagctatctatgaactaggtatgcattgtttgctgtatggtggcttctta
tcaagcatttgctatggtgattcgtgtagcactcgattgatacgaaatgtgatttgtatc
tga

DBGET integrated database retrieval system