KEGG   Spinacia oleracea (spinach): 110786905Help
Entry
110786905         CDS       T05137                                 

Definition
(RefSeq) uncharacterized protein LOC110786905 isoform X1
  KO
K17398  DNA (cytosine-5)-methyltransferase 3A [EC:2.1.1.37]
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe00270  Cysteine and methionine metabolism
soe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:soe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    110786905
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:soe03032]
    110786905
   03036 Chromosome and associated proteins [BR:soe03036]
    110786905
Enzymes [BR:soe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     110786905
DNA replication proteins [BR:soe03032]
 Eukaryotic type
  DNA Replication Termination Factors
   DNA methylation enzymes
    110786905
Chromosome and associated proteins [BR:soe03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    110786905
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP
Motif
Other DBs
NCBI-GeneID: 110786905
NCBI-ProteinID: XP_021847184
LinkDB All DBs
Position
Unknown
AA seq 1129 aa AA seqDB search
MVSVMNNDFDLERNTVSASEAEDSRVSDDGYVVDNVRDEGVSDSHLNSDVKFSSGKDLGA
RISEIDEKGVLERPEWEMEEVRVLVGDADTGYHANGDSGNSLGNDGVEGDGEIEVKVQEI
ESRDGQDEGVSPKGGFTGNFNGVGRVGVHRKRRKAGRKDEGSQIGEFRLETRGYLQGSMS
EPVSASDEDDEMRGGLVMDSRFEMGDMVWGKVKSHPWWPGHMFNEAFATSSVRRTRRHGQ
LLVAFFGDSSYGWFDPTELVQYDPHFAEKSQQTTSRNFVRAVEESIDEASRRSALGLSCY
CRNPNNFRPANVPGYMAVDVVDYEPGAVYSLNQIRKARDSFRPLDALSFIMQLAVAPMSS
ESKNLDFIKNKATTLAYRRSVFEEFDETYAQAFNQHPARSSQLPALPDKVPSRAPLSGPL
VMADTLGGRKSSTKASKTKELSKKERYLFKRRDEAGDLRTTKTTQGHASSSLSVADEDGP
SDTTAATFVFQKRDLAVQDDDLAHVGTTKDALTGLGVMVPSGSREWDSRAMVTADVGDVN
DKVSDKHVNRLSSNDAGHLGVRDGMIKKKKKAAKRPARELNSEKSDLPEKKIKKIRKLDG
KMSIDHVERDTVQSAGMPTDIAASFREDSQASQGRKDNEGISSVSSQVGLVSSGEAKAKD
PELLQLLADLRCLALNPAHGMERNGPAITRQFFLKFRSTFFQKSSSVSASAESEIREDLD
IKSTPASESAEKLSAGNGKGSSVKLQKLSARHEDPIKGRKRMPSERQEEKAAKKAKKITE
AKSLSSEKRALKNPETQQRAEGKAKGAAAQSPQSKPIKSEQRQKKMDRPPKVEDPTYLIM
KFPSGSSLPSLVELKARFARFGQLDTSLSRVFYKTNTCRVAFLYEQDARIACRYAMGSKS
LFSNVKFVVRPVAAPEPQQLSSGRVEDMQSESAANRESSTIESKPVVPTTTVKQPVQQLK
SCLKKPSGGDETGGPGPNNGARTARVRFNMGEVKGGSTDNMGGGVEGQMMESRNLMLSSS
YEGPSSSSSSSIAMDVSNNQRFTVSSHPLQPPVLPHPPQFIRAPINHLHHHMIELSPRNN
LHDNPRLENQAPPQPTRDVSQQMMDLLTRCHDVVTNVKSMLGYVPYHSL
NT seq 3390 nt NT seq  +upstreamnt  +downstreamnt
atggtatcagtgatgaacaacgatttcgatttggagagaaatacagtttctgcttcagaa
gctgaagattctagggtttcggatgatgggtatgttgttgataatgttagggatgaaggg
gttagtgattcgcatttgaattcggatgttaagttttcttctgggaaggatttaggtgcc
cggataagtgaaattgatgaaaagggggttttggagagacctgaatgggaaatggaggaa
gttagggttttggttggggatgcggacacgggttatcatgcgaatggtgattcagggaat
tcactggggaatgatggggtggagggtgatggagagattgaggttaaggttcaggaaata
gagtctagagatggacaggatgaaggtgtgagtcccaaaggggggtttactggtaatttt
aatggtgttgggcgtgtgggtgttcacagaaagaggcggaaggctggtcgtaaagatgag
ggctcacagattggtgaatttaggttggagactcgtggttatttgcaaggttcaatgagt
gaacctgtcagtgctagtgatgaggatgatgaaatgagaggtggattggttatggattcc
aggtttgaaatgggtgacatggtttggggcaaggtgaagtctcatccatggtggccaggt
catatgtttaatgaagcttttgctacttcttcagttcgacggacaaggaggcatgggcag
ttgttggttgcattctttggtgatagtagttatgggtggtttgaccccacagaacttgtt
caatatgaccctcattttgcagaaaaatcgcagcagacgacttcaaggaattttgttagg
gctgtggaggaatcgattgatgaggctagtaggaggagtgctcttggtttaagctgttat
tgtcggaatccaaataacttccgcccagcaaatgtgcctggttacatggctgttgatgtt
gtagattatgaacctggtgccgtttattctctgaatcaaattcggaaggcaagagatagt
ttccggcctttagatgctctttcattcataatgcagttggctgtggcaccaatgagtagc
gaaagtaagaaccttgattttattaaaaacaaagctaccacccttgcttatcgtagatct
gtattcgaagagtttgatgagacgtatgctcaagcttttaatcagcatccggcacggtct
tcccagttgccagcattgcctgataaagtgccatctcgagctcctttgagtggcccgtta
gtcatggcagatactctcggcggtcgaaagagttccactaaagcttcaaaaacaaaggag
ctgtccaaaaaggaaagatacctttttaagcgccgagatgaagctggtgacttgaggaca
acaaagaccacgcaaggtcatgcaagctcctctttgtctgttgcggacgaggatggacca
tctgatacgactgcagctacttttgtgttccagaaaagggatttagctgtccaagacgat
gatctggctcatgttgggaccacaaaagatgctttaacaggtcttggtgtgatggttcct
tctgggtcacgagaatgggattctagggctatggtgacagctgatgtaggcgatgtgaat
gataaggtttcagacaagcatgtcaacagacttagttctaatgatgcaggccatcttggt
gtgagagatggcatgataaagaaaaagaaaaaagctgctaaacgccctgcacgggaactg
aactctgagaaatctgatctgccggagaagaagatcaagaaaattaggaaattagatggt
aaaatgagcatagaccatgttgagagagatacagtacaatctgctgggatgcctaccgat
attgctgcctcatttagagaggactctcaagcaagtcaggggaggaaggacaatgaaggt
atcagttctgtttcttcgcaagtggggttggtgtcatcaggagaagctaaagccaaggat
cccgaactgttacagttgttggctgatttgcgatgtcttgccctgaaccctgcgcatggc
atggaaaggaatggacctgcaattacacgtcagtttttcttgaaatttcggtcgactttt
ttccagaagagctcaagtgtttcagcttctgctgaatctgaaatcagggaggatctggac
atcaaatctacccctgcttctgaatctgctgagaaactttcagctgggaacggtaaagga
tcttctgtaaaactgcagaagctctcagccagacacgaagatcccataaaagggcggaaa
cggatgccatctgagcgtcaggaggaaaaggctgcaaagaaggccaagaaaataactgaa
gcaaaatccctgagttctgaaaagcgtgccctaaagaacccagagacgcagcaacgggct
gagggaaaagctaagggtgctgcagcacaaagcccgcagtcaaaacccataaagtcagag
cagcgtcagaagaaaatggaccgtcctcctaaggttgaggatcccacatatctgattatg
aagttcccgtctggctcctcccttccttcattggtagagctgaaggcaagatttgcccga
tttggccaactggacacatctctcagccgggtcttctacaaaacaaacacttgccgagtt
gctttcctctatgaacaagacgcgagaattgcttgtcgatatgccatgggaagcaaatct
ttgttttcaaatgtgaagtttgtggtgaggccggtggcagcacctgaacctcagcagctg
agcagcggcagggtagaagacatgcagagtgagtctgcagcaaacagagaatcatcaaca
atagagtcaaaacctgtggtccccactacaacggtaaagcagccggtgcagcagctgaag
tcctgcttgaagaagccttctggaggcgacgagactggtgggcctgggcccaacaatggt
gcaagaacagcccgggtgagattcaacatgggtgaggtgaaaggtggtagtactgataat
atgggaggtggtgttgaaggccaaatgatggagtctaggaatttgatgttgtcatcatct
tatgaaggtccttcatcatcttcatcgtcgtctattgctatggatgttagtaacaatcaa
aggttcacagtttcttcacatccattgcaaccccctgttctcccccaccctccccagttt
ataagggctccaataaatcacctacatcatcacatgatagaattatccccaagaaataat
ttgcatgataatccaaggctggaaaatcaagcaccaccacaacccaccagagacgtctca
cagcagatgatggacctcttaacaaggtgccatgatgtggtgaccaacgttaagagcatg
ctaggctatgtgccctatcattctctttga

DBGET integrated database retrieval system