KEGG   Spinacia oleracea (spinach): 110787960Help
Entry
110787960         CDS       T05137                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:soe00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    110787960
Enzymes [BR:soe01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     110787960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 110787960
NCBI-ProteinID: XP_021848291
LinkDB All DBs
Structure
PDB: 

Position
Unknown
AA seq 229 aa AA seqDB search
MQAALAAMAAHTILASAPSHTTFSLISPFSSTPTNALSSSLQSSSFNGLSFKLSPTTQSL
SLSTSAASKPLTIVAATKKAVAVLKGTSNVEGVVTLTQEDDGPTTVNVRISGLAPGKHGF
HLHEFGDTTNGCMSTGPHFNPDKKTHGAPEDEVRHAGDLGNIVANTDGVAEATIVDNQIP
LTGPNSVVGRALVVHELEDDLGKGGHELSPTTGNAGGRLACGVVGLTPV
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcagcattggcagccatggccgcacacaccattctcgcatctgcaccttctcat
acaacattctctctcatctctcccttctcttccacgcccacaaacgccctttcatcttcc
cttcaatcttcttccttcaatggtctctccttcaagctaagcccaaccacccaatccctc
tctctttctacttccgcggcctcgaaaccactcaccattgttgctgctaccaagaaagct
gttgctgttcttaagggtacttctaatgttgagggcgtcgtcactttgacccaagaagat
gatggtccaactacagtcaatgtccgtattagtggacttgctcctgggaagcatggattt
cacttgcatgagttcggagatacaacaaatgggtgcatgtctacaggtccacattttaat
cctgataagaagacacatggtgctccggaagatgaagtccggcatgcgggtgacctggga
aacattgttgctaacacagatggagtggctgaggctaccattgttgacaatcagattcca
ttgactggaccaaattcagttgtcggtagagcccttgtggttcatgaacttgaggatgac
cttggaaaaggtggacacgaacttagtccgaccactgggaatgctggtggaagattggca
tgtggtgtggttggattaactccagtgtag

DBGET integrated database retrieval system