KEGG   Spinacia oleracea (spinach): 110788488Help
Entry
110788488         CDS       T05137                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe00010  Glycolysis / Gluconeogenesis
soe00020  Citrate cycle (TCA cycle)
soe00620  Pyruvate metabolism
soe01100  Metabolic pathways
soe01110  Biosynthesis of secondary metabolites
soe01200  Carbon metabolism
Module
soe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:soe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110788488
   00020 Citrate cycle (TCA cycle)
    110788488
   00620 Pyruvate metabolism
    110788488
Enzymes [BR:soe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     110788488
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 110788488
NCBI-ProteinID: XP_021848826
LinkDB All DBs
Position
Unknown
AA seq 480 aa AA seqDB search
MASLTKLSLSNSNSPAISFSSSLSSSTTSLQWRPSTALPPNPRRKLTRVSAKIREIFMPA
LSSTMTEGKIVSWSKSEGDVLRKGEAVVVVESDKADMDVETFYDGILAAIVVPEGESAPV
GAPIGILAESEEEIEEAKARASQSGSKSEAKIDPPASQATPTVDVPVATPPAPADGGRKG
VATPFAKKLAKQHKVELNSVKGTGPFGRITPEDVEKAAGIVKPSLAIASPPAVAAAPPSS
APAKVAGGSAGSFTEIEGSSVVPFTTMQAAVAKNMMESLSVPTFRVGYPVVTDALDALYA
KVKKKGVTMSALLAKAAAMALVQHPELNSTCKDGKSFTYNSSINIAVAVAINGGLITPVL
QNADKLDLYLLSQKWKELVEKARAKQLQPHEYNSGTFTLSNLGMFGVDRFDAILPPGQGA
IMAVGASKPTVVADADGFFSVKNKMLVNVTADHRIIYGADLAAFLQTFSNIIQNPDSLTM
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcttccctcactaaattatccctctccaattccaattcccctgcaatctccttctca
tcttctctttcctcctccactacctctctccaatggcgcccttccaccgcacttcccccc
aatcctcgccggaaacttaccagagtttccgccaaaatccgcgagatcttcatgccggca
ttgagctcgacgatgacggaggggaagattgtgtcgtggtccaaatcggagggtgatgtt
cttcgaaaaggcgaagcggttgttgttgtggagtctgataaagcggacatggatgtcgag
actttctatgatggaattctcgctgccattgttgtccctgaaggtgaaagtgctcctgtc
ggagctccgattgggatattagctgaatccgaagaggaaatcgaggaggcaaaagctagg
gcttctcagtcgggatcgaaatcggaggcgaaaattgatcctccggcttcgcaggcgact
cctacagttgatgttccggtggctaccccgcctgcgccggcggatggtgggagaaagggg
gtggcgactccttttgcgaagaagttggcaaagcagcataaggtggaattgaattcggtt
aaggggacggggccatttgggaggatcacgccggaggatgtggagaaggcggctggaatc
gtgaagccatcgcttgcaattgcttcgccgcctgctgttgctgctgctccgccttcatcg
gctcctgcaaaggtcgctggcggtagtgctggcagtttcactgaaattgaggggtcatct
gtggtgccattcacaacaatgcaggcggctgtagcgaagaatatgatggagagtttgtca
gtgcccacttttcgggttgggtatccagtggtgactgatgcgcttgacgctctttatgct
aaggttaagaagaagggtgtgacaatgagtgctttgctagcgaaagcggcagcaatggcg
cttgttcagcatcctgaattaaattctacatgtaaggatgggaagagctttacttataat
agcagtattaacattgctgttgctgtggcaatcaatggaggattgatcacacctgtttta
cagaatgcagacaagttggatttgtatttgttatcccaaaaatggaaagaactagtagag
aaggctcgtgccaaacaattgcagcctcatgagtataattcaggtactttcaccttgtca
aatttgggcatgtttggagttgatagattcgacgctatccttcctccaggccagggagcc
attatggctgtgggagcatcaaagcctactgttgttgctgatgctgacggtttcttctca
gtaaaaaataaaatgctggtcaatgtcacagctgatcaccgaatcatctatggtgctgac
ttagctgccttcctccagaccttttcaaatatcatccaaaacccagacagtttaacaatg
tag

DBGET integrated database retrieval system