KEGG   Spinacia oleracea (spinach): 110789251Help
Entry
110789251         CDS       T05137                                 

Definition
(RefSeq) small nuclear ribonucleoprotein-associated protein B'
  KO
K11086  small nuclear ribonucleoprotein B and B'
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:soe00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110789251
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:soe03041]
    110789251
   03032 DNA replication proteins [BR:soe03032]
    110789251
Spliceosome [BR:soe03041]
 Complex A
  U1 snRNP components
   Sm proteins
    110789251
  U2 snRNP components
    110789251
 Complex B
  U1 snRNP components
    110789251
  U4/U6.U5 tri-snRNP components
    110789251
 Complex C
  U2 snRNP components
    110789251
DNA replication proteins [BR:soe03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     110789251
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LSM
Motif
Other DBs
NCBI-GeneID: 110789251
NCBI-ProteinID: XP_021849590
LinkDB All DBs
Position
Unknown
AA seq 292 aa AA seqDB search
MSMSKGSKMLQFINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRKLPPTKGSKTN
KANPNEEREERRTLGLVLLRGEELISMTVEGPPPPEESRAKSMSATAVAGSGLGRAAGRG
IPTAPLVHAQPGLAGPVRGVGGPAPGMMQPQISRPPVPAPQFSAPGMTYPNAPVMRPPGQ
QMPGYPPQGPPQMPPRGPPPPGQFPPGSRPGPAPPGHFQMPPQYAQRPGMPGPPPPMMRG
PPPPPRPGMQAPPPPRPGMPPPPGGQVPVYGPPRPGMPPPPNSQQPPQNQQQ
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatgtctaagggttcgaagatgctccagtttatcaattaccggatgcgggtcaca
atccaagacgggcgtcaactcgtaggaaaattcatggcctttgatcgtcacatgaaccta
gtccttggcgattgtgaggaatttcgtaagctgcctcccactaagggaagcaaaaccaac
aaagcaaaccctaatgaggagagagaagagcgccgtacccttggccttgttcttcttagg
ggtgaagaattgatttccatgactgttgaaggacctcctcctcctgaagagtcacgtgcc
aagtccatgagcgccactgccgtcgcgggttcgggtcttggccgagctgctggaaggggt
attccaactgctccacttgttcatgctcagcctggtttggctggtccagttcgtggtgtt
ggtggtccagctccgggcatgatgcagcctcagatctctcgaccaccagttccagctcct
cagttttcggctcctgggatgacttacccaaatgcacctgtgatgcggccaccgggtcag
cagatgccaggatatccacctcaaggaccaccacagatgccaccgagaggcccacctccc
ccggggcagtttcctccaggatcaaggcctggtccagctcctccagggcatttccaaatg
cctcctcagtatgctcagcgtcctggaatgcctggcccacctcctcccatgatgcgtggc
cctcctcctcctcccaggcctgggatgcaagctccaccacctcctcgccctggcatgcca
ccaccacctggaggacaggtgccagtctatggacctcctcgtccggggatgccacctcct
ccaaactctcaacagccacctcagaatcagcagcagtaa

DBGET integrated database retrieval system