KEGG   Spinacia oleracea (spinach): 110794473Help
Entry
110794473         CDS       T05137                                 

Definition
(RefSeq) serine/threonine-protein kinase AtPK2/AtPK19-like
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
soe  Spinacia oleracea (spinach)
Brite
KEGG Orthology (KO) [BR:soe00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:soe01001]
    110794473
Enzymes [BR:soe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110794473
Protein kinases [BR:soe01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   110794473
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Pkinase_C Kdo RIO1 APH Haspin_kinase FTA2
Motif
Other DBs
NCBI-GeneID: 110794473
NCBI-ProteinID: XP_021855148
LinkDB All DBs
Position
Unknown
AA seq 475 aa AA seqDB search
MVSTSQIPSKPLHKILASKLTLTIPPSKSSSSSPPTEEFDFSDVFGPNPTPSSSSQAPLP
RDPPVIHYRTHSFLGPSPRYIPNSQPFHQIPEEIISQITDDDDEIEVKRDENDGTFIEQL
VCIEEEEEEREDGVISKVGPEDFEILRVIGKGAFGKVFQVRKKGGCGGDGSGGDGILAMK
VMRKDNIIKKNHVDYMKAERDILTKVDHPFIVQLRYSFQTKSKLYLILDFLNGGHLFFHL
YRQGIFSEDQARLYTAEIVSAVSHLHKNGIVHRDLKPENILMDADGHIVLTDFGLAKEID
ESSRSNSLCGTMEYMAPEIIQAKGHNKNADWWSVGILLYEMLSGKPPFSHANRQKLQQKI
INEKVKLPSMVSTEAHSLLRGLLQKDPSKRLGSGPGGSDEVKTHKWFRPINWKKLEAKEL
QPKFKPDVNGKECTANFDKCWTTMPANDSPASTPTGNEHFVGYSYVAPNPWLSSE
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggtatctacatctcaaattcccagcaaacctctacacaaaattctagcatccaagcta
accctaacaatcccaccttcgaaatcatcatcttcttcacctcctactgaagaattcgat
ttctccgatgtttttgggcccaacccaactccttcatcttcttcccaagctccattaccg
agggacccaccagtgattcactaccgtactcactctttcctggggccctcacctcgttac
atacctaattctcaaccttttcaccaaatcccagaagaaatcatatcccagatcacggat
gatgatgatgaaatcgaggtgaaaagggatgagaatgatgggacttttatcgaacagttg
gtgtgcattgaggaggaggaggaggagagagaagatggggttatttcgaaagtgggtccc
gaggattttgagattttgagggtaattgggaaaggggcttttgggaaggtgtttcaggtt
agaaagaaagggggttgtggtggtgatggcagcggcggcgatggtattttggccatgaaa
gttatgaggaaagataacattattaagaagaatcatgttgattatatgaaagctgagagg
gatattcttaccaaagttgatcatccttttattgttcagcttaggtactcttttcagaca
aagtcgaagctttatctaattttagattttttaaatggaggacacctgttttttcatctc
tacagacaggggattttcagtgaggatcaggcaagactttacactgctgagatagtatct
gctgtgtcgcatcttcacaagaacgggattgtgcatcgagatctcaaacctgaaaatatt
ctcatggatgctgatggacatattgtactcactgattttggacttgccaaagaaattgat
gaatcaagcagatcaaattctttgtgtggaaccatggaatacatggctccagaaatcata
caagccaaaggtcataacaagaatgctgattggtggagtgtcggaatcctgttatatgaa
atgttaagtgggaagcctccattctcacatgccaacagacagaaactccaacagaaaatc
attaatgagaaagttaagcttccatcaatggtatccactgaagcacattctttgctaaga
ggactgttgcaaaaggacccttcaaagaggcttggtagtgggcccggtggatcggatgaa
gtgaagacccacaaatggttccgtcctatcaactggaagaaattggaggcaaaagaattg
cagccaaagttcaaaccagatgtgaacggaaaggaatgcactgccaactttgacaaatgc
tggacaacgatgccagcaaacgactcacctgcttctacacccaccggtaatgaacatttt
gtaggttatagttatgttgctcccaacccgtggctttcatctgaatga

DBGET integrated database retrieval system