KEGG   Spinacia oleracea (spinach): 110795645Help
Entry
110795645         CDS       T05137                                 

Definition
(RefSeq) histone deacetylase 5
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
soe  Spinacia oleracea (spinach)
Brite
KEGG Orthology (KO) [BR:soe00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:soe01009]
    110795645
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:soe03019]
    110795645
   04131 Membrane trafficking [BR:soe04131]
    110795645
   03036 Chromosome and associated proteins [BR:soe03036]
    110795645
Enzymes [BR:soe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     110795645
Protein phosphatases and associated proteins [BR:soe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110795645
Messenger RNA biogenesis [BR:soe03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     110795645
Membrane trafficking [BR:soe04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    110795645
Chromosome and associated proteins [BR:soe03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     110795645
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 110795645
NCBI-ProteinID: XP_021856362
LinkDB All DBs
Position
Unknown
AA seq 644 aa AA seqDB search
MEEGGSSERNDRVRQRVGLVYDEKMCNHNTPDGEDHPECPDRIRVIWNKLRNSGLIDRCV
VLNAKEAEDKYVQSVHSKRHVDLIRNISSKRFDSRRDRTASKYNSIYFNKGSSEAAYLAA
GSVIEAADKVAKGELNSAFAIVRPPGHHAEENEPMGFCLFNNVAVAASYLLNERPELGIH
RILIVDWDVHHGNATQKMFWKDSRVLFFSVHRHDFGCFYPGTDDGSHTMIGEGPGEGYNI
NVPWEHGRCGDADYFAAWDHVLIPVVKEFNPDMIIVSAGFDAAVRDPLGGCCISPYGYSV
MLRKLMDFAQGKILLSLEGGYNLQSLADSAHACVQVLLDEKPIIGSSEAYPFESTWRVIE
NVRQKLSVFWPSLSDELPKKLTSQKASTPQPLTDVSSESESEDIEEAIKSIIQPLSELKF
DEDQKDDSASWRTEHKLTDIWYASFGSNMWKPRLLCYIQGGQVEGMQKPCSGSMDRSPPK
DVMWKTVPHRLFFGRDYTNTWGPGGVAFIHPESSPVEKAYICMYKLTLEQFNDILFQENC
SSCDADAPWFSSEALNAIKNRGSVSIVKGGWYHNVVFLGEEQGVPILTMTCDLHDVQAFK
SLEVPQCAPSNAYVNTLIRGLSEGGQLSEEEVLAYIDKAAATSL
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaggaggaagttccgagcgaaatgatagggtgcggcaacgtgtagggttagtt
tatgatgaaaaaatgtgcaaccataacactcctgatggtgaagatcaccctgaatgtcct
gatcgaattagggttatttggaacaaacttcgcaattccggtctcattgataggtgtgtt
gttctgaatgccaaggaagcagaagataaatacgtacaatctgttcattccaaaaggcat
gttgatctgattcgtaatataagctccaagcggtttgattctcgcagggatagaaccgct
tcaaaatacaattccatttattttaacaaaggttcatcagaagcagcttatttagctgca
ggctctgttatagaggcggcagataaagtagccaaaggggagctcaattctgcttttgca
attgtgaggcctcctggccatcacgctgaggaaaacgagcccatgggtttttgcctgttc
aataatgtggctgttgcagctagttatctgctgaatgaaagaccagaattaggcattcac
agaattttgattgttgattgggatgttcatcatggcaacgccactcagaaaatgttttgg
aaggattctcgtgttcttttcttctcggtacataggcatgactttggatgtttctatcct
ggaactgatgatggctctcatactatgattggagaaggaccaggggagggatacaacatt
aatgttccctgggaacatggtcgctgtggtgatgcagactattttgctgcttgggatcat
gtattgatcccagttgttaaagaattcaacccggatatgattatagtttctgccgggttt
gatgcagctgtccgtgatcctcttggcggttgttgtatttctccatatggctactctgtt
atgttgagaaagttaatggattttgctcaaggtaaaattttactttctctggaaggcggg
tacaatcttcaatctttggcggattccgctcatgcatgtgtgcaagtattgttagatgaa
aagccaatcatcggatcttctgaggcatatccatttgaatcaacatggcgcgtcatagaa
aatgttcggcaaaagttaagtgtgttttggccaagcctctccgatgaattaccaaagaag
ttaacaagccagaaagcgtctacgcctcagccactaactgatgtgagctctgagtctgaa
agcgaagatattgaggaagctatcaagagtattatacaacccctttcagaactgaaattt
gatgaagatcagaaggatgattcagcttcctggcgaacggagcacaagctaactgatatt
tggtacgcatcctttgggtcaaatatgtggaaaccgaggcttctctgctatatccaaggt
ggacaggtggaaggtatgcaaaagccatgttctggttccatggacagaagccctccaaaa
gatgtcatgtggaagactgttcctcatagattgttctttggccgtgattacacaaataca
tggggtcctggtggagttgctttcattcaccctgaaagtagtccagtggaaaaagcttat
atctgcatgtataaacttacgctagagcagttcaatgatattttgtttcaagaaaattgt
tcaagttgtgatgctgatgctccttggtttagttcggaagctctaaatgctattaaaaat
aggggatccgtctccattgttaagggaggttggtatcataatgtagtctttttgggcgag
gagcagggtgttccaatactgaccatgacgtgtgatctgcatgatgtacaggccttcaaa
tctttagaagtaccacaatgtgctcctagcaatgcatatgtcaataccttaatcagggga
ctatccgaaggaggacagctttctgaagaagaagtgttggcctacatagataaagctgct
gctacatcactctga

DBGET integrated database retrieval system