KEGG   Spinacia oleracea (spinach): 110796043Help
Entry
110796043         CDS       T05137                                 

Definition
(RefSeq) histone-lysine N-methyltransferase EZ1
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:soe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    110796043
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:soe03036]
    110796043
Enzymes [BR:soe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     110796043
Chromosome and associated proteins [BR:soe03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     110796043
   Polycomb group proteins
    PRC2-EZH2 complex
     110796043
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 110796043
NCBI-ProteinID: XP_021856763
LinkDB All DBs
Position
Unknown
AA seq 884 aa AA seqDB search
MSAVPKEIISVIDSLKQQVEAQRHVYVKNLMEENKQKLSKVTLMKERRSVTVNDMEKNAG
LLVKKQNDAVNMQNDFESGNKGDDCNGSQENSAILLGSPFPNKNTIRATKLPEVKRLPPY
TTWIFLDRNQRMTEDQSVLGRRRIYYDPTGGEALICSDSEEEVIEDEEDKKAFARSEDYI
LRMTVQEAGLSDAVLDLLGQCFSKKPSDVKARYEVLCGEEKATEGLRKGETVETSENSNP
YLDKDLEGALDSFDNLFCRRCYVFDCRLHGCSQDLIFPTEKQHPWSSSEEANVTCGLHCY
RSAPKCEGDSVVISHKCDGPEARASLSSDDAFVEVSPRKKSNGSSNKRKGSTQSESASSN
ARSASDSSDSDERLAQDNNSVDQPSIHHKGKLIGKSGPRKSRNKRAAERIIVAMQKRHKK
AVAQDADSISAGPTLSRDMKLRSRARKEDEVASSSKKKGNSSTGEKSRKASPAVGSSQSL
NCDSEPLNIALTDQSMGILDDVSRKEELVDESPGKLEVYNDNSWKALEKALYEKGLEIFG
RNSCLIARNLLNGLKTCSEVYQYMNRLNNKLSCQGGDDESNLECNETTGNEVRRRSRYVR
RRGRVRRLKYTWKSTGYHSIRKRISERKDQPCRQYNPCGCEAACGKQCSCLLNGTCCEKY
CGCPKSCKNRFRGCHCAKSQCRSRQCPCFAADRECDPDVCRNCWVSCGDGTLGVPNQRGD
NYGCRNMKLLLKQQQRVLLGRSDVSGWGAFLKNGVGKHEYLGEYTGELISHREADKRGKI
YDRENSSFLFNLNDQFVLDAYRKGDKLKFANHSPDPNCYAKVIMVAGDHRVGIFAKERIN
AGEELFYDYRYEPDRAPAWARKPEEPGSKKEAAGPSTGRAKKLA
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcggtaccgaaagagattatttcggttattgattcattgaagcaacaagttgaa
gctcaacggcatgtttatgttaagaacttaatggaagaaaacaagcaaaagttatccaaa
gtgactttaatgaaggaaagaagaagtgtgacggttaacgacatggaaaaaaatgccggt
ttattggtaaaaaagcagaatgatgcggttaatatgcaaaatgatttcgaatcaggtaac
aagggtgatgattgcaatggttcacaagaaaattcagcgatacttctgggttctcctttc
cctaataagaatactatccgagcaactaaacttcctgaagtgaagagattaccaccttat
actacatggatatttttggacagaaaccaaaggatgacagaagaccaatcagtgctaggt
cgaagaagaatttattatgatccaactggcggggaagctttgatttgcagtgacagtgag
gaggaagtaattgaggatgaagaagacaagaaggcatttgctagatcagaagattacatc
ctgcgaatgacagtgcaggaagctggtttatcagatgctgttttggatttactgggacag
tgcttttccaaaaagcctagtgatgtcaaggcaagatatgaagttctttgtggggaagag
aaggctacggaaggtctaagaaagggggagaccgtagagacttcagaaaattcaaacccg
tatctcgataaagatttggaaggagctttggattcttttgacaacttgttctgtcgccgg
tgttacgtttttgattgtagattgcatggatgctcacaagatctcatttttcctactgag
aaacaacacccttggagttcttcggaagaggcaaatgtaacatgtgggttgcactgctat
cgttcggctcccaagtgtgaaggtgattctgtagttatctcccataaatgtgatggccct
gaagcaagggctagtctttcttctgatgatgcttttgttgaggtatcaccaagaaagaag
tctaatggttcttccaacaagcgaaaggggtccactcaaagtgaaagtgcctcgtcaaac
gcaagaagtgcatctgatagtagtgattcagatgaaagacttgctcaagataacaactct
gttgaccaaccttctatccatcataagggtaagttgattgggaaatctggacctcgcaaa
agtaggaacaagcgagctgctgaaaggataattgttgcaatgcagaagaggcataagaag
gcggtggctcaagacgctgattcaattagcgctgggcctaccttgtctagagatatgaaa
cttcgatctcgggcacgcaaggaggatgaagttgcaagttcttcgaagaagaaaggaaat
tcaagcactggtgaaaagtcaagaaaggcttcaccagctgtgggcagctcccagtccttg
aattgtgatagtgagcctttaaatatagcactcactgaccaatctatgggtattttggat
gacgtgtcaaggaaagaagaacttgtagatgaaagccccggaaaactagaagtatacaat
gataattcttggaaggcccttgaaaaagcactttatgagaagggcttggagattttcggc
aggaacagttgtttgattgctagaaaccttttgaatggactgaagacatgttcagaggtt
taccagtacatgaatcgcttgaataataagctatcctgccaaggtggtgatgatgagagt
aaccttgaatgcaatgaaactacgggtaatgaagtcaggaggagatcaagatatgttcgg
cggagaggtagagttcgtcgtttgaagtatacttggaagtctactggttaccattccatc
agaaaacgaatttcagagaggaaagatcagccttgtcgacagtataatccttgtgggtgt
gaagctgcttgcggaaagcagtgttcatgtcttttaaatggtacatgctgtgaaaaatat
tgcgggtgtcctaagagctgcaaaaatagattccggggatgccactgtgctaaaagtcaa
tgcagaagtcgtcaatgtccatgctttgctgcagatagggaatgtgatccggatgtctgt
cgtaattgctgggtgagttgcggtgatggtacacttggtgtcccaaatcaaagaggtgac
aattatggatgtagaaatatgaagcttttgctcaagcaacaacaacgggttctacttggt
aggtctgatgtttctggttggggagcatttcttaagaatggtgttggtaaacatgaatac
cttggagagtacactggggagttaatctcacatcgagaagccgataagcgtggaaaaata
tatgatcgtgaaaattcctcatttctcttcaatctcaatgaccagtttgttctagatgct
tatcggaaaggggacaagttgaaatttgccaaccattctcctgatccaaattgttatgcg
aaggttattatggtagctggtgatcatcgagtgggcatatttgctaaggaaagaataaat
gcaggggaagaacttttctatgattatcgttatgagccagatcgagctccagcctgggcc
cgtaagcccgaggaacctggatctaaaaaagaggctgcgggtccttccaccggtcgtgca
aagaagctcgcttaa

DBGET integrated database retrieval system