KEGG   Spinacia oleracea (spinach): 110796539Help
Entry
110796539         CDS       T05137                                 

Definition
(RefSeq) glutamate decarboxylase-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe00250  Alanine, aspartate and glutamate metabolism
soe00410  beta-Alanine metabolism
soe00430  Taurine and hypotaurine metabolism
soe00650  Butanoate metabolism
soe01100  Metabolic pathways
soe01110  Biosynthesis of secondary metabolites
Module
soe_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:soe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    110796539
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110796539
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110796539
   00430 Taurine and hypotaurine metabolism
    110796539
Enzymes [BR:soe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     110796539
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 110796539
NCBI-ProteinID: XP_021857291
LinkDB All DBs
Position
Unknown
AA seq 503 aa AA seqDB search
MVISDTTSSADASNKTLCCTFASRYVRNALPRFQMPEKSIPKDAAYQIINDELMLDGNPR
LNLASFVTTWMEPECDKLIMSSINKNYVDMDEYPVTTELQNRCVNIIANLFNAPVGKEES
AVGVSTVGSSEAIMLAGLAFKRKWQERRKAEGKPCDKPNIVTGANVQVCWEKFARYFEVE
LKEVNLKEGYYVMDPEKAVDMVDENTICVAAILGSTLTGEFEDVKLLNDLLIKKNKETGW
DTPIHVDAASGGFIAPFIYPDIEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRTKDDLP
EDLVFHINYLGSDQPTFTLNFSKGSSQIIAQYYQLIRLGFEGYKNIMENCRENAKMLKEE
IQKIGKFEVVSKDIGVPVVAFSLKDSDNYSVFDIAENLRRFGWIVPAYTMPANAEHIAVL
RVVIREDFSRSLAERLMSNLQQVLDEMDAHAIQVSSKSASVTLDKDKTQGNKAFIKKDVI
ETQREVTKYWKKLVARNKENGVC
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggtgataagtgacacaacttcttctgcagatgcttccaacaaaacgttgtgttgcacc
tttgcttctcgctatgttcgcaatgcacttcctaggtttcaaatgccagagaaatctata
ccgaaggacgcagcttaccagataataaatgatgagctgatgctagatgggaatccaagg
ttgaatcttgcatcatttgtgactacttggatggagcctgagtgtgataagctgattatg
tcttccatcaacaaaaattatgttgacatggacgagtaccctgtcactactgaacttcag
aatcgttgtgtgaacattattgcaaacctttttaatgctcctgttggaaaagaagaatca
gcagttggagtaagcactgtagggtcttcagaggcgatcatgttggcgggtttagctttt
aaaaggaaatggcaggaaaggcggaaagcagaaggaaaaccttgtgataaacctaatata
gttaccggagcaaacgtgcaggtttgttgggaaaaatttgcaaggtactttgaggtagaa
ctgaaggaggtcaatttgaaagaaggatattatgtaatggatccagagaaagctgtggat
atggtggatgaaaataccatatgtgtagcagctattctgggttccaccctgacaggagag
tttgaggacgtaaagctccttaacgatctcctaataaaaaagaacaaggagactggatgg
gacacacctattcatgttgatgctgctagtggtggatttatcgctccttttatttatcct
gatattgaatgggactttcggttgccattagtgaagagcattaatgttagtggtcacaaa
tacggccttgtttatgctggtataggctgggttgtctggaggaccaaagatgacttgcca
gaagatcttgttttccatatcaattaccttggatctgatcagcccactttcacactcaac
ttctccaaaggttcaagtcagatcattgcgcaatactatcagttgatacggcttggcttt
gagggttacaagaatatcatggagaattgcagggaaaatgccaagatgttgaaagaagaa
atacaaaagatagggaaatttgaagtggtctccaaggatataggtgtcccagtggtggca
ttttctctaaaggatagcgacaactactctgtttttgacatagcagagaatttaaggcgt
tttgggtggattgtcccagcttacacaatgccagccaatgctgagcacattgcagtattg
cgtgtggtgataagggaggattttagcaggagtcttgcagagagacttatgtccaacctc
cagcaagtcctagatgagatggatgctcatgcaatccaagtttctagcaaatcagctagt
gtcactcttgacaaggataaaactcaagggaacaaggcctttatcaagaaagatgtgata
gagacacaaagggaagtaaccaagtactggaaaaagcttgttgcccgaaataaggagaat
ggagtttgctag

DBGET integrated database retrieval system