KEGG   Spinacia oleracea (spinach): 110798993Help
Entry
110798993         CDS       T05137                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain 2, chloroplastic-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe00630  Glyoxylate and dicarboxylate metabolism
soe00710  Carbon fixation in photosynthetic organisms
soe01100  Metabolic pathways
soe01200  Carbon metabolism
Module
soe_M00165  Reductive pentose phosphate cycle (Calvin cycle)
soe_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
soe_M00532  Photorespiration
soe_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:soe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    110798993
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    110798993
Enzymes [BR:soe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     110798993
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 110798993
NCBI-ProteinID: XP_021859885
LinkDB All DBs
Position
Unknown
AA seq 180 aa AA seqDB search
MASSMLSNAAVATTVVNRNAGAQASMVGLKSVAAFPLTKKSTNDLSSLPTNGGRVQCMKV
WPTQNMKRYETLSYLPPLTTDQLARQVDYLLNNKWVPCLEFETEHGFVYREHHNSPGYYD
GRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAFIRIIGFDSNRQVQCVSFIAYKPEGY
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctctatgctctccaacgccgcggtggctaccaccgttgtcaaccgcaatgct
ggtgctcaagctagcatggttgggttgaaatctgttgcagctttcccacttaccaagaag
tctaccaatgacctctcttccctcccaaccaacggtggaagagttcaatgcatgaaggta
tggccaacacaaaacatgaagaggtacgagactctatcgtaccttccacctcttaccaca
gaccagttggcgcggcaggtcgattaccttcttaacaataaatgggttccttgcttagaa
ttcgagactgaacatggatttgtataccgtgagcaccacaattccccagggtactatgac
ggtcgttactggacaatgtggaagttgccgatgttcgggtgcactgacccggcccaggtt
ttgaatgagctcgaagaatgcaagaaggagtaccccaacgccttcatccgtatcattgga
ttcgacagcaaccgtcaagtccaatgtgtcagtttcattgcctacaagcctgaaggctac
taa

DBGET integrated database retrieval system