KEGG   Spinacia oleracea (spinach): 110799192Help
Entry
110799192         CDS       T05137                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe00250  Alanine, aspartate and glutamate metabolism
soe00410  beta-Alanine metabolism
soe00430  Taurine and hypotaurine metabolism
soe00650  Butanoate metabolism
soe01100  Metabolic pathways
soe01110  Biosynthesis of secondary metabolites
Module
soe_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:soe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    110799192
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110799192
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110799192
   00430 Taurine and hypotaurine metabolism
    110799192
Enzymes [BR:soe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     110799192
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 110799192
NCBI-ProteinID: XP_021860104
LinkDB All DBs
Position
Unknown
AA seq 500 aa AA seqDB search
MSLSKTATASDASVHSTFASRYVRVCLPRFKMPDNSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLMMDAINKNYVDMDEYPVTTELQNRCVNMIANLFNAPLGESEVAVG
VGTVGSSEAIMLAGLAFKRRWQNRRKALGLPTDKPNIVTGANVQVCWEKFARYFEVELKE
VKLSDGYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKLLNDLLEAKNKETGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGVGWVIWRSKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQIIAQYYQLIRLGFEGYKNIMENCQENAMILKDGIEK
TGRFNIISKDIGVPLVAFSLKDNSLHNEFEISDMLRRFGWIVPAYTMPPDAQHVTVLRVV
IREDFSRTLADRLVADLQKVLNELDALPARVSAKLNVANSEEGGDDQISRKKSALQMQME
VCSVWKKFVDDKKLKTNGVC
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtctctctcgaaaactgcaactgcatctgatgcttccgttcattccactttcgcttcc
agatatgttcgcgtctgtcttcccaggtttaagatgccagataattcgataccgaaagaa
gcagcgtatcaaataataaacgacgagttgatgttggatggaaatccaaggttgaatttg
gcgtcatttgtgacgacatggatggaaccagagtgcgataaattgatgatggatgccatt
aacaaaaattatgttgacatggatgagtaccctgttactactgagctccagaatagatgc
gttaacatgatagccaacttgtttaatgcgccacttggagagtcggaggttgctgttgga
gttggaactgtgggctcctcagaggctatcatgcttgctggtcttgcattcaaaaggagg
tggcaaaacagaaggaaggctttgggcttacctactgataagcccaacattgttactggg
gccaatgtccaggtttgttgggagaaatttgcaagatattttgaagtggagttgaaggaa
gttaagttaagcgatggatactacgttatggaccctgagaaggcagtggaaatggttgat
gagaacaccatctgtgttgctgctatccttggatccacactcaatggagagtttgaagat
gtcaagctcttgaacgaccttctcgaggccaagaacaaagaaaccggatgggatactcca
attcacgtggatgcagcaagtggtggtttcatcgcgccatttttgtatccagagttggaa
tgggactttagattgccattggtgaagagtatcaatgtaagtggtcacaagtatggactt
gtgtatgccggtgttgggtgggtcatctggaggagcaaagaggacttgcctgaagaactc
atcttccacatcaactaccttggtgctgatcaacccactttcactctcaatttctccaaa
ggatcaagtcaaattattgctcaatactatcagctgattcgtctgggattcgaggggtac
aagaacatcatggagaactgccaagagaatgccatgatcttgaaagacggcattgagaag
acaggtcgcttcaacatcatatccaaagacatcggagttccactagttgcattctctttg
aaagacaacagtctccacaatgagtttgagatttcagacatgcttcgtaggtttgggtgg
attgtaccagcttacaccatgccaccagacgcgcagcatgtgactgtgttgcgtgttgta
atcagagaggacttctctcgtacacttgcagaccgtctggttgctgaccttcagaaagtc
ctcaacgaacttgacgcccttcctgcccgtgttagtgctaagttaaatgttgcaaactcc
gaggaaggtggtgatgatcaaatctctaggaagaagagtgccctgcaaatgcaaatggag
gtttgcagtgtttggaagaagtttgttgatgacaagaagctcaagaccaatggtgtttgc
tag

DBGET integrated database retrieval system