KEGG   Spinacia oleracea (spinach): 110800933Help
Entry
110800933         CDS       T05137                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe00564  Glycerophospholipid metabolism
soe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:soe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    110800933
Enzymes [BR:soe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     110800933
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 Pyr_redox NAD_binding_8 GIDA FAD_binding_3 HI0933_like Pyr_redox_3 Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 110800933
NCBI-ProteinID: XP_021861945
LinkDB All DBs
Position
Unknown
AA seq 627 aa AA seqDB search
MASTALRLRRIGAIAAAATTAASVAFTVSVSSNDRGISVAPEIQGKVSDLNAVVPPRRAQ
ISSLAGSTADKPLDMLVIGGGATGCGVALDAATRGLRVGVVEREDFASGTSSRSTKLIHG
GVRYLEKAVFNVDYGQLKLVFHALKERKQLIDNAPHLCHSLPCMTPCFGWFEVVYYWAGL
KLYDIVAGARLLHLSRYYSAQQSIELFPTLTRMGNDRSLKGTVVYYDGQMNDSRLNVGLA
CTAALAGASVLNHAEVISLLKDEVDGRIIGARIHDNLSGEEFDTYAKVVVNAAGPFCDFV
RKLADTAAQPMISPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGKTLAGTTDS
NTAITMLPEPHEDEIQFILDALTDYLCIKVRRTDVLSAWSGIRPLAMDPTAKNTESISRD
HVVCEDFPGLVTITGGKWTTYRSMAEDAVDAAIKSGKLKADECKTHNLILTGGYGWDPAN
FTVIAQQYVRTKKTSDGRTVPGVMDTAVAKHLSQAYGTLAERVASISQNEGLGKRLAHGY
PFLEAEVAYCARYEYCESATDFIARRCRLAFLDTDAASRALPRVIEILAAEHKWDKSRKN
DEFKKAKEFLETFKSSKNAQFHDGKHK
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggcctcaacggcactccgcctccgccgaattggcgccatcgccgctgctgcaaccacc
gccgcttccgtcgcatttactgtgtcagtttcctccaatgacagagggattagtgtggcc
cccgaaatccaggggaaggtttctgacttaaacgctgtcgtacctcctaggcgggctcaa
atttcgtctctggcggggtccaccgctgataaacctctggatatgctcgtgattggtggt
ggcgcgacagggtgcggtgtcgcccttgatgctgcaacgagaggcctccgggtgggggtt
gtggaaagggaggattttgcttccgggacttcttccaggtctaccaagttaatccatgga
ggtgtacgctaccttgagaaagctgtgttcaatgttgattatgggcagctgaagcttgtt
ttccatgcacttaaggaacgtaagcagctgattgataatgctccacatctatgccactct
ttgccatgcatgaccccatgttttggatggtttgaagtggtgtactactgggcgggcttg
aaactatacgatatagttgcaggggcaaggttgctacatctatcaaggtattattcagcg
caacagtctattgagctcttccccactcttacgagaatgggaaacgatagaagtttaaag
ggcactgtagtgtattatgatgggcagatgaatgactctcgacttaacgttggtttggca
tgcacagcagcattagctggggcctctgtgcttaatcatgctgaagttatttcattactt
aaggatgaagttgatgggcggataattggtgcaagaatacatgacaatctctctggtgaa
gaatttgatacatatgctaaagttgtggtgaatgctgctgggcctttttgtgactttgtt
cggaaattggctgatacggctgcgcagcccatgatatctcctagcagtggtgtacatatt
gttctccctgactactattctccagaagggatggggttaattgttccgaaaactaaggac
ggacgtgttgtgttcatgcttccatggctgggcaagacattagcagggaccacagattcc
aataccgccattacaatgctgccagaaccacatgaggatgagattcaattcatattggac
gctctcactgattatctctgtatcaaggttcgtcgaacagatgttctctctgcatggagt
ggaattcgtccattggctatggatccaacagccaagaacacagaaagtatctcccgtgat
cacgttgtttgtgaagatttccctggtttggttaccataactggtggaaaatggaccaca
tatagaagcatggctgaggatgctgttgatgctgcaattaagtccggaaagctgaaagcc
gatgaatgcaaaactcacaacttgatacttactggtggttatggttgggatcctgccaat
tttactgttattgctcaacagtatgtccgaacaaagaagacgtctgatggtagaaccgtt
cctggtgtcatggacactgctgtagcaaagcatttatcacaagcatatggtacactggct
gagcgcgtggcttcaatatctcagaatgaaggtttgggaaagcggctcgcgcatggatac
cctttccttgaagcagaagtagcatactgtgctcgatacgagtattgtgagtctgcaact
gattttattgcaaggagatgtcggcttgctttcctagatactgatgctgccagtcgagct
ctgcctcgcgtcattgaaattctagcagcagaacataaatgggataaatctagaaagaac
gatgagtttaagaaggctaaggagttcctggaaaccttcaaatcatcaaaaaatgctcag
tttcacgatggtaaacacaaatag

DBGET integrated database retrieval system