KEGG   Spinacia oleracea (spinach): 110802817Help
Entry
110802817         CDS       T05137                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHR2
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe00310  Lysine degradation
soe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:soe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    110802817
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:soe03036]
    110802817
Enzymes [BR:soe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     110802817
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     110802817
Chromosome and associated proteins [BR:soe03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     110802817
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 110802817
NCBI-ProteinID: XP_021863972
LinkDB All DBs
Position
Unknown
AA seq 399 aa AA seqDB search
MAVADNHAALSTVLRLVNIEGKGRGLVASQPLKGGQIILRDSPILTYSAFPLKRLQQQGI
CSSNSRYCAHCYKLLVTGSATSACPSCSHPNDAIFCSPRCQSVALGFTHTPWVCQSLSYL
RNCSVLVNQQPEERQVQARYLVAAFNLAMVSPSSFQTLISLDGGGPHGGERDSDAAIFLH
SIISSLPFPEGLSAPSLEITASLLSKDRCNAFGLMEPFSEHRERSVRAYAIYQNASLFNH
DCLPNACRFDYVDGGNEGNTDMVIRMIHDVPEGREICLSYFPVNLSYPQRQKRLLDDYGF
SCICDRCKIEANWSHEDGDGEDDTMEEEDEEMSPSDGENNEIEQEAEEEDDFPHAYFFMR
FLCDKENCGGTLAPLSPSNNNSPNIMECNVCGSTKKEEL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggctgtagcagataatcacgcggccttgtcaaccgttctgagattggtgaacattgaa
gggaagggaaggggtctagtagcatctcagccgcttaaaggaggacagataattctccga
gactcccccatcctaacttattctgcttttcctctgaaacgactacaacaacaagggatt
tgctcctctaactctagatactgtgctcattgttataagctcttggtcactggaagtgcg
acatcagcgtgtccttcatgttctcatcccaatgatgctatcttttgcagcccgagatgt
caatccgtggcccttggcttcacacacacaccatgggtgtgccaatctcttagttattta
agaaattgctctgtactagttaaccagcagcctgaggaacgtcaggtccaagctcgttat
ctggtggctgccttcaatcttgctatggtttctccttcctcctttcaaactctgatatca
cttgatggaggtgggccacatggcggagagagagattctgatgccgccatctttctacac
tctatcatctcatcactaccttttcccgagggtttatctgccccatctttagaaattact
gcttctcttttatccaaggacaggtgtaatgcctttggactcatggagcctttttcagaa
cacagagaaagatctgtgagagcttatgctatttatcaaaatgcttcattatttaaccac
gattgcctgcctaatgcatgtcgttttgactatgttgatggtggaaatgagggaaacact
gatatggtcattagaatgatacatgatgttcctgaaggccgagaaatttgtttgagttat
ttcccagtcaatctaagctatcctcaacggcaaaagaggttgttggatgattatggtttt
tcttgtatttgtgatcgatgcaagattgaggctaactggtctcatgaggatggagatggt
gaggatgacaccatggaggaggaggatgaggaaatgtctccctcagatggggagaataat
gagattgagcaagaagcggaggaggaggatgattttcctcatgcttatttttttatgaga
tttttgtgcgataaagaaaattgtggaggcactttggctccgttgtcaccgtctaataac
aactcacctaatatcatggaatgtaatgtttgtggcagtacgaagaaagaagagttgtag

DBGET integrated database retrieval system