KEGG   Spinacia oleracea (spinach): 110803013
Entry
110803013         CDS       T05137                                 

Definition
(RefSeq) cytochrome P450 86A1
  KO
K15401  long-chain fatty acid omega-monooxygenase [EC:1.14.14.80]
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe00071  Fatty acid degradation
soe00073  Cutin, suberine and wax biosynthesis
Brite
KEGG Orthology (KO) [BR:soe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110803013
   00073 Cutin, suberine and wax biosynthesis
    110803013
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:soe00199]
    110803013
Enzymes [BR:soe01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.80  long-chain fatty acid omega-monooxygenase
     110803013
Cytochrome P450 [BR:soe00199]
 Cytochrome P450, plant type
  CYP86 family
   110803013
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 110803013
NCBI-ProteinID: XP_021864160
LinkDB
Position
Unknown
AA seq 528 aa
MDTMQMQVFIGIVAMVSVYMLWFSHLSKRLNTGPNLWPLIGSLPYLFKNRHRLHDWMAGN
LRRTSGAATYQTCTIALPFLAYKQGFYTVTCHPKNIEHILRTRFDNYPKGPQWQAAFHDL
LGQGIFNSDGETWLLQRKTAALEFTTRTLRQAMNRWVNRTIRTRLWKILETAENEKKPVD
LQDLLLRLTFDNICGLTFGKDPMTLSPGLPDNPFSSAFDSATESTLQRLLYPGFLWRLKK
IFQIGAEKRLQNSLQVVENYMSGALNARKENPSDDLLSRFMNKRDQNGNVFADDVLKRIA
LNFVLAGRDTSSVALSWFFWLVMNHPEIEAKIIDEISTVLKQTRGDDSEKWVREPLEFDE
ADKLVYLKAALAETLRLYPSVPEDFKYVVNDDVLPDGTIVPAGSTVTYSIYSVGRMKTVW
GEDCMEFRPERWLSEPVSGSGYRFEPPKDGYKFVAFNAGPRTCLGKELAYLQMKSVASAV
LLRYRLLPVPGHRVEQKMSLTLFMKNGLQVYVEPRELKGGASEVATCA
NT seq 1587 nt   +upstreamnt  +downstreamnt
atggacaccatgcaaatgcaagtctttataggcattgtggccatggtatcagtctatatg
ttatggttctctcacttgtctaaacgtctgaatacaggtccaaacctatggcctcttatt
ggaagcctcccatatctattcaagaaccgacaccgcctccatgactggatggccgggaat
ctccggcgaaccagtggggccgccacataccaaacatgcaccatagccttacctttcttg
gcatacaagcaagggttttacacggttacgtgccaccccaaaaatatagagcatattctt
cgtactcggttcgataattaccccaaaggcccacaatggcaagcagcctttcatgattta
ctaggccaaggcatttttaacagcgacggtgaaacttggcttttacaacgtaaaaccgct
gccctagagtttactacaaggactctacgtcaagccatgaaccggtgggtgaaccggact
attagaacccggctatggaagattttggaaaccgctgaaaatgagaaaaaaccggttgat
ttacaagacttgcttcttaggcttactttcgacaatatttgtgggttgacttttgggaag
gacccgatgactttatcaccgggtctacccgataacccgttttcatcggcttttgactca
gctaccgagtctaccctccagaggctactatacccaggttttttatggaggttaaaaaag
atatttcaaataggagctgaaaaaagattacaaaacagcttacaagttgtggaaaattac
atgtcaggagcacttaacgcaagaaaagagaacccttctgatgatctactttcaaggttc
atgaacaagagagatcaaaacggcaacgttttcgccgacgatgtccttaaacgcatagct
ttgaacttcgtccttgctggacgtgacacgtcatccgttgccctgagctggttcttctgg
cttgtgatgaatcaccctgagattgaagcaaagatcattgatgaaatatcaacggttctt
aagcagacacgtggcgacgactcggaaaaatgggtccgggaaccactggagtttgatgaa
gctgataaactggtttatctcaaggcagcattagctgagactttacgtttatacccctcc
gtcccggaggacttcaagtacgttgtaaacgacgacgttttgccagatgggactatagtt
ccagcggggtccacagtgacgtactcgatctactccgtagggagaatgaaaacggtttgg
ggagaagattgcatggagtttagaccggagaggtggttgagtgaaccggtatctggttca
ggttaccggtttgaaccgccaaaggatgggtataagtttgtggcctttaatgcaggccca
agaacttgtctagggaaagagttggcttacttgcagatgaaatctgtggcttctgctgtg
ttgctccggtaccggttattgccggttcccggtcatcgggtggagcagaagatgtctttg
actctgtttatgaagaatggactccaggtttatgttgagcctagagagctcaagggtggt
gctagtgaagtggctacctgtgcgtag

DBGET integrated database retrieval system