KEGG   Spinacia oleracea (spinach): 110803626Help
Entry
110803626         CDS       T05137                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH3 isoform X1
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:soe00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    110803626
Enzymes [BR:soe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     110803626
Chromosome and associated proteins [BR:soe03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     110803626
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 110803626
NCBI-ProteinID: XP_021864841
LinkDB All DBs
Position
Unknown
AA seq 377 aa AA seqDB search
MQSAEQDGIGNVSDKLPEQLGNQNEIGNVFDKLTKQLGNPVEFELPDWSNKLQSAPYILI
KRNIYMTKKPKRRHEDDGIFCSCGPSTGSNASCGRDCHCGMLLSACSSNCKCGDDCVNKP
FQQRPVKKLKLVQTEKCGSGIVAVEDIKQGEFVIEYVGEVIDDKTCEERLWKMKETGVTN
FYLCEINRDMVIDATAKGNKSRYINHSCCPNTEMQKWSIDGETRIGIFATRDIEKGEHLT
YDYQFVQFGADQDCHCGADSCRQKLGVKPSKKILSSDAALKLVAHQVAASSSKVKAILLG
KNVYQNGSFHGAPGQRRNSFNCIGEVVRISGPDYMRSFGIIRRFDNITKKHLIMFADGSD
EFIDMSKVDWEFCNFLL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcagtctgcagaacaggatgggattgggaatgtatccgacaagttgccagagcaactg
ggcaatcagaatgaaattgggaatgtattcgacaagttgacaaagcaattgggcaatcct
gttgagtttgaacttccagactggtcaaataaattgcagtctgctccatatattttaata
aaacgcaatatatatatgactaagaaaccaaagaggcgccatgaggatgatggcatcttt
tgctcttgtggtccatctacagggtctaatgcttcctgtggaagagactgccactgtggg
atgttgctctctgcctgctcctcaaactgtaaatgcggagatgattgtgttaacaaacca
tttcagcagcgccctgtgaaaaagttgaaactagtgcagactgagaaatgtggatcaggc
attgtggctgttgaagatattaagcaaggagaatttgttatagaatatgtaggagaagta
attgacgataaaacttgtgaagaaaggttatggaaaatgaaagagaccggtgtaacaaat
ttctatctttgtgagattaaccgagatatggttatcgatgccactgccaagggtaacaaa
tcaagatacataaatcacagttgctgtcccaacacggagatgcagaaatggagtatagat
ggagaaacaagaattggtatatttgctacacgtgacatagaaaagggcgagcatctgaca
tatgattatcagtttgttcaatttggtgcagatcaagattgccattgtggtgctgatagt
tgcagacagaaacttggtgtcaaacctagcaagaagattctttcgtctgatgccgcatta
aaactagttgcacatcaggtagcagcatcatcttccaaagtgaaagcaatattattggga
aaaaatgtttatcagaatggaagttttcatggagcgccaggtcaaagaagaaactccttt
aattgcattggtgaagttgtcaggatttctggccctgactatatgaggtcatttggtata
ataaggcggtttgataacattacaaagaagcacttgatcatgtttgcagatggaagtgat
gaatttattgacatgtccaaagtagattgggaattttgtaacttcttattgtag

DBGET integrated database retrieval system