KEGG   Spinacia oleracea (spinach): 110803652Help
Entry
110803652         CDS       T05137                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe00020  Citrate cycle (TCA cycle)
soe00190  Oxidative phosphorylation
soe01100  Metabolic pathways
soe01110  Biosynthesis of secondary metabolites
soe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:soe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110803652
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    110803652
Enzymes [BR:soe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     110803652
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 110803652
NCBI-ProteinID: XP_021864871
LinkDB All DBs
Position
Unknown
AA seq 632 aa AA seqDB search
MWRCVTRGLRAHSSKTSPISSQSLFPRFFSSLSNPVSGSSYTVVDHTYDAVVVGAGGAGL
RAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLG
DQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLNFGKGGQAYRCACAAD
RTGHALLHTLYGQAMRHNTQFFVEYFALDLIMDDEGACQGVIALNMEDGTLHRFRSKSTI
LATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLEDLEFVQFHPTGIYGAGCLITEGSRG
EGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPMKDHIYLHLNHLPP
EVLQERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYYGEVVTIKGDNPDAVI
PGLLAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAETTKPGENQKPLPKDAGEKT
IEWLDKLRNSNGSLPTSQIRLNMQRVMQNNAAVFRTQSTLEEGCQLIDETWETFHDVQVK
DRGLIWNTDLIETIELENLLINACITMHSAEARKESRGAHAREDFTTRDDQNWMKHTLGF
WENEKVRLDYRPVHLNTLDDEVESFPPKARVY
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggtgcgtcacccggggtcttcgtgcccattcctccaaaacttctccgatctct
tcccaatctctcttccccagattcttctcctctctatccaatccggtgagtgggtccagc
tacacggtggtagaccacacctacgatgcggttgtcgtcggagcaggtggtgccggttta
agagccgccatcgggttgtcggaacatggattcaacaccgcttgtattactaagcttttt
cctactcgttctcacaccgttgctgctcagggtggaatcaatgctgctttgggtaatatg
agtgaagatgactggagatggcacatgtatgacaccgttaaaggaagtgactggttaggt
gaccaggatgccatacagtatatgtgtagagaggcaccaaaagctgtgattgagctcgag
aattatggtttgccgttttctcgaacagaagacgggaaaatatatcaacgcgcgtttggt
ggtcaaagcttgaactttgggaaaggggggcaggcctaccgatgtgcatgtgctgctgat
cgaactggccatgctttgttgcacactctttatggacaagctatgaggcataatacacaa
ttttttgtggaatactttgcattggaccttattatggatgatgaaggtgcttgccaaggt
gtaatcgctttgaatatggaagatgggacgttgcatagattccgttctaaatcaacaatt
ttggctactgggggatatggtcgagcatatttttctgcaacctctgcgcacacatgtacc
ggagatggaaatgcaatggtggcacgtgctggccttccgttggaggatcttgaattcgtg
caattccacccaactggtatctacggtgctggatgcctaatcactgaagggtcccgtggt
gaaggtggtattctgagaaatagtgaaggtgagcgattcatggaaagatatgctccaaca
gctaaagatcttgcatccagggatgttgtatctagatctatgacgatggagattcgagaa
ggccgcggtgtaggaccaatgaaggatcatatttaccttcacttgaatcacctgcctccg
gaagtacttcaggaaagacttcctggtatctctgagacagctgctatctttgccggggtt
gatgttacaaaggaacccatcccagtcttgccaactgttcattataacatgggtggtatt
cccacaaactactatggagaggttgtcaccattaaaggtgataatccagatgcagtcatt
cctggattgttggctgctggggaggctgcttgtgcatcagttcatggtgctaaccgtctt
ggtgccaattctcttcttgacattgttgtttttggtcgagcttgtgctaaccgagttgcg
gaaaccactaaaccaggggagaaccagaaacctttgcctaaggatgctggggagaagact
atagagtggttagacaaattaagaaattcaaatggctctcttccaacttcccaaatccgc
ctgaacatgcaacgagttatgcagaataatgctgctgtcttccgaacacagagtacactg
gaggaaggttgtcaattgattgatgaaacatgggagactttccatgacgttcaagtcaaa
gaccgcggtttgatatggaatactgatttgatcgaaaccatagagttagaaaatttgttg
attaatgcctgcatcaccatgcactctgctgaggctaggaaagagagcagaggagctcat
gcccgtgaagatttcacgacaagagatgatcaaaattggatgaaacacactctaggattt
tgggagaacgagaaggttagactagattatcgaccagttcacctaaacacattggacgac
gaggtggagtctttccctcctaaagctcgtgtatattga

DBGET integrated database retrieval system