KEGG   Spinacia oleracea (spinach): 110804359Help
Entry
110804359         CDS       T05137                                 

Definition
(RefSeq) serine/threonine-protein kinase AtPK2/AtPK19-like
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
soe  Spinacia oleracea (spinach)
Brite
KEGG Orthology (KO) [BR:soe00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:soe01001]
    110804359
Enzymes [BR:soe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110804359
Protein kinases [BR:soe01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   110804359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo APH Pkinase_C RIO1 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 110804359
NCBI-ProteinID: XP_021865640
LinkDB All DBs
Position
Unknown
AA seq 488 aa AA seqDB search
MVYSQFSVLSESCKSFQSHLLRPDNPPNAVPADDDEFDFSDVFGPLPGQFPVEVNEGILE
TAGADLSELVYDDPVVVYRRSHSLVGPSACVSHSLKLSKLCLRETEEADVLVECVNGATT
EETSEISTDDDVKPFDSLNDDLLTKDQKVGLEDFEIMKVVGQGAFGKVYQVLKKGTSEIY
AMKVMRKDKIMEKNHGEYMKAERDILTKIGHPFIVQLRYSFQTKYRLYLVLDFINGGHLF
FQLEKHGLFREDLARIYAAEIVSAVSHLHANGIMHRDLKPENILLDAEGHVMLTDFGLAK
ELEENGRSNSLCGTVEYMAPEIVLAKGHDKAADWWSVGVLIFEMLTGQPPFFGGNRDKIQ
KKIIKDKIKLPAFLTSEAHSLLKGLLQKEPSRRLGSGATASEEIKLHKWFKPIVWKKLEA
RQVQPSFRPEVAGKLCTVNFDKRWTDMPVVISPAASPNGNGNLLFKDFTYVRPASSFLQK
MSPLNERV
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggtgtattctcagttctctgttttgagtgagagttgcaaatcctttcaaagccatttg
ctgcgtcctgataaccctccaaatgctgttcctgcagatgatgatgagtttgatttttct
gatgtttttggtcctctaccagggcagtttccagtcgaagtaaatgaagggattttggaa
actgcaggtgctgatttgagcgaacttgtttatgatgacccagttgttgtgtacaggcga
tcacattctctagttggcccttctgcttgtgttagtcattcgttgaagctcagtaagctc
tgtcttcgagagacagaggaagcagatgtcttagtggagtgtgttaatggcgcaactact
gaagaaacttcagaaatttcaacggatgacgatgtaaagccttttgattccctgaatgat
gatcttttgacaaaggaccaaaaagtaggccttgaagattttgagataatgaaagtggtc
gggcaaggtgcatttggtaaggtataccaggtactcaagaagggtacttctgaaatatat
gcaatgaaggtcatgcgaaaggataagataatggagaagaaccatggtgagtatatgaaa
gcagagagggatattttgacaaagattggtcatcctttcattgtccagctcagatactca
tttcaaaccaaatacagattgtaccttgtgctggatttcataaatgggggtcacctgttc
tttcagcttgaaaaacacggtcttttcagggaagatctggctcgtatatatgctgcggaa
atcgtttctgcagtgtctcacctccacgcgaatggtataatgcacagggatctgaagccc
gaaaatatcctacttgatgcagagggccatgttatgttaactgattttggtcttgctaaa
gaactggaagagaatgggaggtcaaactctttgtgtgggacagtggaatatatggcacct
gaaattgttctggcaaagggccacgacaaggctgcggactggtggagtgtaggtgtcttg
atatttgagatgcttactgggcagcctcctttctttggtggtaacagggacaagatccag
aaaaagatcataaaagataagatcaagctaccagctttcttaactagtgaagcgcattct
ctgctgaaagggctgttacaaaaagagccaagcaggcgtctgggtagtggagcaacggca
agcgaggaaataaagctccataagtggtttaagccaattgtttggaagaaactagaagca
aggcaagttcaaccaagcttccgcccagaagttgccggaaagctatgcactgtcaacttt
gataagcgctggaccgacatgcctgttgttatttctcctgctgccagtcccaatggcaat
gggaatctcctcttcaaggatttcacatatgtaagaccagcttcgagttttcttcagaag
atgagtcccctgaatgagcgtgtttga

DBGET integrated database retrieval system