KEGG   Streptococcus cristatus: I872_02215Help
Entry
I872_02215        CDS       T02649                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
soi  Streptococcus cristatus
Pathway
soi00473  D-Alanine metabolism
soi00550  Peptidoglycan biosynthesis
soi01100  Metabolic pathways
soi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:soi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    I872_02215 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    I872_02215 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    I872_02215 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:soi01011]
    I872_02215 (ddl)
Enzymes [BR:soi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     I872_02215 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:soi01011]
 Precursor biosynthesis
  Amino acid ligase
   I872_02215 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 DUF1246 GARS_A
Motif
Other DBs
NCBI-ProteinID: AGK70553
UniProt: N0C2L7
LinkDB All DBs
Position
458685..459731
Genome map
AA seq 348 aa AA seqDB search
MVKQTLILLYGGRSAEREVSVLSAESVMRAINYDKFSVKTYFITKAGDFIKTQEFTEKPA
ADEKLMTNATVDVSQQVKPSDIYEENAVVFPVLHGPMGEDGSIQGFLEVLRLPYVGCNIL
SSSVAMDKITTKRILESAGIPQVPYVAVIEGENLEEKIAEIEEKLTYPIFTKPSNMGSSV
GISKSENQEELRAALDLAFKYDSRVLIEQGVNAREIEVGLLGNYDVKSTLPGEVVKDVAF
YDYEAKYIDNKITMDIPAKISDEVISVMRTNAETAFRALGGQGLARCDFFYTEDGDIFLN
ELNTMPGFTQWSMYPLLWENMGLPYSELIEKLVNLAEEAFAKREAHLL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaacaaaccttgattttactatacggtggtcgtagtgctgagcgagaagtttca
gtcttgtcggctgagagtgtcatgcgagctatcaattatgacaaattttctgtcaagact
tatttcatcacaaaagctggcgattttatcaagacgcaggaatttacagaaaagccggct
gcagatgaaaaactcatgaccaatgcaacggttgatgtttcacagcaagtcaaaccgagt
gacatttatgaggaaaatgcagttgtctttcctgttcttcatggaccgatgggcgaggat
ggctctattcaaggctttcttgaagtgctgcggcttccttatgtgggctgcaatatcttg
tcttccagtgttgccatggacaaaattaccaccaaacgtattttggagtctgctggaatt
ccgcaggtgccttatgtagcagtgattgagggagaaaatctggaagaaaaaattgccgaa
atcgaagaaaaattaacttatccgatttttaccaaaccgtctaatatgggctctagtgtc
ggtatttcaaagtctgaaaatcaagaggagctgcgggcagcattggatttggccttcaag
tatgacagccgtgtcttgatcgagcagggagtcaatgcgcgtgagattgaggttggtctc
ttagggaattatgatgttaagagtaccttgccgggcgaagtggtcaaagatgtggctttc
tacgactatgaagccaagtatattgacaataagattaccatggatattcctgcaaaaatc
tcagacgaggttatttcagtcatgcgtacgaatgctgagacagcctttcgtgccttgggt
ggacagggattggcgcgctgtgatttcttctacacagaggatggcgacattttcctcaat
gagctcaataccatgccaggctttactcaatggtctatgtatcccttgctttgggaaaat
atgggactgccttattccgagttgattgagaaattggtaaatttagctgaagaggccttt
gctaagagagaagcgcatcttttataa

DBGET integrated database retrieval system