KEGG   Streptococcus cristatus: I872_03470Help
Entry
I872_03470        CDS       T02649                                 

Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
soi  Streptococcus cristatus
Pathway
soi00500  Starch and sucrose metabolism
soi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:soi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    I872_03470
Enzymes [BR:soi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     I872_03470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: AGK70794
UniProt: N0CCY3
LinkDB All DBs
Position
complement(714925..716373)
Genome map
AA seq 482 aa AA seqDB search
MENQTLMQYFEWYLPNDGQHWNRLAEDAPHLASKGIRKIWMPPAFKATSSNDVGYGVYDL
FDLGEFDQKGTVRTKYGFKEDYLNAIQTLKANGIEPMADVVLNHKAAADYKERFTVVEVD
PNDRNIEISKPFEIEAWMHFTFPGRNKNYNDFEWHWYHFTGTDYDAQNNKSGIYLIQGDN
KGWADDELVDNENGNYDYLMYADIDFKHPEVIQNLYDWAYWFIETTGVQGFRLDAVKHID
SFFMRNFIRDITAKYGEDFYVFGEFWNSDETANNDYLKNIEYRFDLVDVKLHHNFFDASI
AGSDFDLRTIFDQTLAKNHPESAVTFVDNHDTQRGQALESTVEEWFKPAAYALILLREEG
LPCVFYGDYYGISGEFAQESFQDVLDKLLDVRLNLAYGEQTDYFDDANCIGWTRQGKDDG
QPIAVVVSNDQASSKRMLVGSQWAGREFSDYLGKSSQIVTIDEEGWGEFPVEEKSVSVWS
VK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatcaaacattgatgcaatattttgaatggtacttaccaaatgatggacaacat
tggaatcgcttggcggaggatgctcctcatctagcatcaaaaggcattcgcaaaatttgg
atgccaccagcttttaaagcaacgagctccaatgatgtcggctacggagtttatgatctc
ttcgacctaggtgagtttgaccaaaaaggaactgtccgcaccaaatatggttttaaggaa
gactacctaaatgctatccaaactctcaaagccaatggcattgaacccatggctgatgta
gttcttaatcacaaagctgctgcggattacaaagagcgctttactgtcgttgaagtggat
cccaacgaccgaaacatagaaatctcaaaaccatttgaaatagaagcgtggatgcatttt
actttcccaggccgcaataagaactacaatgactttgaatggcattggtaccacttcact
ggtacggactatgatgcccaaaacaacaagtccggtatttatctcatccaaggagacaat
aaaggctgggcggatgatgagctagtggacaatgaaaacggaaactatgactatctcatg
tatgccgatattgacttcaagcacccagaagtcatccaaaatctctacgactgggcctac
tggtttatcgaaacaactggcgttcaaggatttcgtttagatgctgtcaagcacattgac
tccttctttatgagaaattttatccgcgatataactgcaaaatacggtgaggatttctat
gtttttggggaattttggaacagcgatgagacggctaataacgactatctaaaaaatatc
gaataccgctttgatctggttgacgtcaagctccaccataatttctttgatgctagtata
gctgggtcagactttgacctacggacgatttttgatcagacgcttgccaagaatcatcct
gaatcagccgtgaccttcgtggacaatcacgacacccagcgaggacaagctctggagtcc
accgtcgaagaatggttcaagccagcggcctatgctcttatcctacttcgagaggaggga
ctgccttgcgtcttttatggtgactactatggtattagtggagaatttgcccaagagagc
ttccaagacgtgctggacaagctcttggatgtccgcctcaatctcgcttacggcgagcaa
actgactactttgacgatgccaactgtatcggctggactcgccaaggcaaggacgacggt
caaccaatcgctgttgttgtcagcaatgaccaagccagcagcaaacgtatgctggtcggc
tcacaatgggctggtagagaattcagcgattatctgggcaagagctctcaaatcgtgacc
attgacgaagaaggctggggagaatttccagtggaggaaaagtcagtcagtgtctggtct
gtcaaataa

DBGET integrated database retrieval system