KEGG   Streptococcus cristatus: I872_06910Help
Entry
I872_06910        CDS       T02649                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
soi  Streptococcus cristatus
Pathway
soi00620  Pyruvate metabolism
soi00680  Methane metabolism
soi01100  Metabolic pathways
soi01120  Microbial metabolism in diverse environments
soi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:soi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    I872_06910
  Energy metabolism
   00680 Methane metabolism
    I872_06910
Enzymes [BR:soi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     I872_06910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AGK71466
UniProt: N0C907
LinkDB All DBs
Position
complement(1395079..1397925)
Genome map
AA seq 948 aa AA seqDB search
MSFTKLENYSNKEVIREEVGILTDLLIDITQNILSPDTFAKISTIEELAVHAKYQELKAV
VEELSTDDMVYISRYFSILPLLINISEDVDLAYEINHQNNINQDYLGKLSTTIDLLSTRE
NAQEILENLNVVPVLTAHPTQVQRKTMLDLTNHIHTLLRQHRDVKAGLVNEKKWLANLRR
YIELMMQTDMIREKKLKVTNEITNVMEYYNSSFLQAITNLMLEYKRLAEEKGLHLENPKP
ITMGMWIGGDRDGNPFVTAETLKLSATVQSEVILNHYIDKVYTLYRNFSLSTKLSKTSEA
VAKMAALSNDKSVYRENEPYRRAFHYIQSKLIQTLLYLKEGNFSSEGHRLADKAEAVLYA
NVATSVSHNGREIIPNYIQSRLSDSLDELRKEELPSYKNAQEFKDDLLVIRDSLLEHNGQ
ALVTGELTELLQAVDIFGFFLASIDMRQDSSVHEACVAELLASANIVKDYSSLPEEEKCQ
VLLKQLLEDPRILSATHAPKSELLQKELEIFKTARQLKDAIGEDVIKQSIISHSTSVSDL
LELAIMLKEVGLIDEEGARVQIVPLFETIEDLDNSCDTIEKYLSLPIAQKWIASKNNYQE
IMLGYSDSNKDGGYLSSCWTLYKAQQQLTAIGDKFGVKITFFHGRGGTVGRGGGPTYEAI
TSQPLRSINDRIRLTEQGEVIGNKYGNKDAAYYNLEMLVSAAINRMISSKKSDSDTTNEY
ERVMDRVVNRSYQIYRDLVFGDERFYDYFFESSPIKAISSFNIGSRPAARKTITEIGGLR
AIPWVFSWSQSRVMFPGWYGVGSSFKEFIDEDPEKNLAFLQFMYKRWPFFQSLLSNVDMV
LSKSNMNIAFEYAQLCEDQDVRDIFNIILDEWQLTKDVILAIEGHDELLAENAYLKDSLD
YRMPYFNVLNYIQLELIKRQRRGELSPEQERLIHITINGIATGLRNSG
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttacaaaattagaaaattatagcaataaagaagtgattcgggaagaggttggc
attttaacagacttgctgatagatattacccaaaatattctcagccctgacacctttgct
aaaatctccacgattgaagaactggcagttcatgctaaataccaagagctaaaagcggtg
gtagaagaactgtctacggatgatatggtttatatttcacgctacttctctattttaccc
ctgctcatcaatatctcagaagatgttgacttggcttatgagattaaccaccaaaacaat
atcaatcaagactatcttggtaagctttcaacgactattgatttactttcgacacgagaa
aatgcgcaagaaatcttggaaaatctgaatgttgtccccgttttgaccgcccatccgact
caggtgcagcgcaagaccatgctggatttgacaaatcacattcacacgcttttgcgtcag
catcgcgatgttaaagctggtctggtgaatgaaaagaaatggttagccaatctccgtcgc
tatattgagctgatgatgcagaccgatatgattcgggaaaagaaactaaaggtgaccaat
gaaatcaccaatgtcatggaatattataacagttcttttctgcaggccatcacaaatctt
atgctggagtataagcgcttggcggaagagaagggactgcacttggaaaatcctaagccc
atcaccatgggaatgtggattggtggcgaccgcgatggaaatccatttgtaactgctgag
accttaaaattgtctgcgacggtgcagagcgaagttattctgaatcattacattgacaaa
gtttatacactttaccgtaatttctctctgtctaccaagctttcaaaaacgagcgaagct
gtagcgaagatggcagccttgtcaaacgacaagtctgtgtatagagaaaatgaaccttat
cgccgcgcctttcattatattcagtccaaattgattcagactttactttatctgaaagaa
ggcaatttctctagtgaaggacatcgtttggctgacaaagcggaagcagtcctgtatgca
aatgtcgctacttcagtcagccataatggtagggaaatcattccaaactatatccagtct
agactcagtgatagcttagatgagttacgcaaagaagagctcccatcttataaaaatgcg
caagagtttaaggatgatctacttgtcatccgcgattcattgctggagcataatggacaa
gctctggtgactggagaactcactgaattgctacaagcagttgacatttttggtttcttc
ttggctagtattgatatgcgtcaggattccagtgttcatgaggcttgtgtggcggagctc
ttggcttctgctaatatcgtaaaagattacagcagcctgccagaggaagaaaagtgccaa
gttctcctgaagcagcttttggaggatccacgaatcctgtcagcaactcatgcacctaag
tctgaacttctacaaaaagaattggagattttcaagacggctcgtcagctcaaggatgcg
attggcgaagatgttatcaagcaaagtattatttcccattcgactagcgtatcagatttg
ctagagttggcgattatgctcaaggaagtcggcttgatcgatgaagaaggtgcgcgtgtg
cagattgtccctctatttgaaacgattgaggacttggataactcctgcgatactattgag
aaatatctatctctgccaattgctcaaaaatggattgcttctaaaaacaactaccaagaa
atcatgctgggctactcagacagtaacaaggacggtggctacttatcatcttgctggact
ctctacaaggctcagcaacagctgacagccattggcgacaagtttggcgtcaagattact
ttcttccatggtcgtggaggaactgtcggtcgtggcggtggtccaacctatgaagcaatc
acttcacaaccattgcggagtatcaatgatcgtatccgcctgacagagcagggagaggtc
attggcaataaatacggcaacaaggatgctgcttactataatctggaaatgctcgtatct
gctgctattaaccgcatgataagctctaagaagagtgacagtgatacaactaacgagtac
gagagagtcatggatcgagtagtgaatcgaagctaccaaatctatcgcgatttagtcttt
ggtgacgaacgtttctacgactatttctttgagtctagtcctattaaggcgatttctagc
tttaatatcggatctcgtccagccgcccgtaaaaccatcactgaaatcggtggcctaaga
gccattccttgggtcttctcttggtctcaaagtcgggttatgttccctggttggtatggt
gtcggctccagcttcaaggaatttattgatgaagatcctgaaaagaatctagccttccta
cagtttatgtacaagagatggccattcttccagtcccttttgtcaaatgttgatatggtc
ctgtccaagtccaatatgaatatcgcctttgagtatgcgcaactttgtgaagatcaagat
gtgcgggatattttcaatatcatcctagatgaatggcagctgaccaaggatgttatcttg
gcgattgaaggccatgatgagctcttggcagaaaatgcctatctcaaggatagtttggac
tatcggatgccttactttaatgtgttaaattatattcagctggagttgatcaagcgtcag
cgccgtggagaactttcaccagagcaagaacgcttgattcacattaccatcaacggaatt
gcaacaggtctccgaaattctggctga

DBGET integrated database retrieval system