KEGG   Streptococcus cristatus: I872_07220Help
Entry
I872_07220        CDS       T02649                                 

Definition
(GenBank) superoxide dismutase, manganese-dependent
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
soi  Streptococcus cristatus
Brite
Enzymes [BR:soi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     I872_07220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AGK71528
UniProt: N0C5C8
LinkDB All DBs
Position
complement(1456850..1457455)
Genome map
AA seq 201 aa AA seqDB search
MAIILPDLPYAYDALEPYIDEETMHLHHDKHHQTYVNNVNAALEKHPEIGEDLEKLLADV
ESIPADIRQAVINNGGGHLNHALFWELMTPEKTAPSAELAAAIDATFGSFEEFQAAFTAA
ATTRFGSGWAWLVVNKEGGLEVVSTPNQDTPISDGKTPILGLDVWEHAYYVKYRNVRPDY
IKAFFSVINWNKVDELYAAAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcaattattttaccagatctaccttatgcatacgatgctttggaaccttacatcgat
gaggaaacaatgcaccttcaccatgacaagcaccatcaaacttacgtgaataacgtaaat
gcggcgcttgaaaaacaccctgaaattggtgaagacttagaaaaactgttggcagatgtt
gagtctattccggctgatattcgccaagcagtgatcaacaacggtggtggacacttgaac
cacgctcttttctgggaattgatgactcctgagaagacagctccttcagcagaacttgca
gcagcaatcgatgcgacatttggctcattcgaagaattccaagcagccttcactgcagca
gcaacaactcgtttcggttctggttgggcatggttggttgtcaataaagaaggtggtttg
gaagttgtttcaactcctaatcaagacacaccaatttctgatggtaaaacaccaatcctc
ggattggacgtttgggaacatgcttactacgtgaaataccgcaacgtgcgtcctgactac
atcaaggctttcttctcagttatcaactggaataaagtggatgaactctacgcagcagct
aaataa

DBGET integrated database retrieval system