KEGG   Streptococcus cristatus: I872_08050Help
Entry
I872_08050        CDS       T02649                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
soi  Streptococcus cristatus
Brite
KEGG Orthology (KO) [BR:soi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:soi01001]
    I872_08050
Enzymes [BR:soi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     I872_08050
Protein kinases [BR:soi01001]
 Serine/threonine kinases: Other
  Bacterial family
   I872_08050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH RIO1 Kinase-like Kdo Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AGK71690
LinkDB All DBs
Position
complement(1623070..1624941)
Genome map
AA seq 623 aa AA seqDB search
MIQIGKIFAGRYKIIKQIGRGGMADVYLARDLILDGEEVAVKVLRTNYQTDPIAVARFQR
EAKAMADLDHPYIVRISDIGEEDGQQYLAMEYVSGLDLKRYIKENSPLSNEEAVRIMGQI
LLAMRLAHTRGIVHRDLKPQNVLLTPDGNAKVTDFGIAVAFAETSLTQTNSMLGSVHYLS
PEQARGSKATVQSDIYAMGIIFYEMLTGHIPYDGDSAVTIALQHFQKPLPSIIAENPNVP
QALENVVIKATAKKLSDRYQSVAEMYVDLSSSLSYDRRNEKKLVFDDGAKADTKTLPKVP
PVPQSAPSPVAEAVAPKVAADVKRETPVLKAPVKKPKKRHLRARYKVMFLAILLVFAAFF
FLLYKSPANTTVPDVAGQTVAEARSTITAKGLEVGEIKEDYSDNVAEGKVIKTDPPVNSQ
RRENSKVDLIVSKGSKTFTVENYVGQKSSEAVEHLKSTYNIPEKLIKIVEEENSDVEEGV
VISQTPAAGSSYDVTSNKQITLTVAKTVTRVEMPDFGHLQVSYAYARAYLMEMGISASRI
ERVIDRSVESSQADLVTSQSPAAGQSIKLKSNTKITFYVTDGTVTSSSSSSERTQPSSSS
SSTSEEESHSSSSSSSTTASTSH
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaatcggcaagatctttgccgggcgatataaaatcatcaagcagattggccgc
ggaggcatggccgatgtctatctggcacgagatctgatacttgatggtgaggaagttgct
gtaaaggttcttagaaccaattatcagacggatccgattgcagttgctcgcttccagaga
gaagccaaagcgatggcggacttggatcatccttacattgtccggatttccgatattgga
gaagaagatggccagcagtatctggctatggaatacgtgtctgggcttgacctcaaacgc
tatatcaaagaaaattctccactttcaaatgaagaagcagtccgaatcatgggacaaatc
ctactagctatgcgtttagcgcatacacgcgggattgtccatcgtgacttaaaaccccaa
aacgttctcttgacgccagatggcaatgccaaggtaacagactttggaattgccgtggct
ttcgcagagaccagcctgacccagaccaattcgatgctggggtcggtgcattatctttcg
ccagaacaggcgcgtggctctaaagccactgttcagagcgacatttatgccatggggatt
attttctacgagatgctgacagggcatatcccttatgacggagatagtgctgtaacaatt
gccttgcagcatttccaaaagcccctgccgtcaatcatcgcagaaaatccgaatgtccct
caggccttggaaaatgtggtcattaaggcgacggctaaaaagctgagcgatcgctatcag
tccgttgcggagatgtatgttgacttgtctagcagcttatcctatgaccgccgaaatgaa
aagaaactggtctttgatgatggagccaaggcagatactaaaactctgccaaaagttcct
ccggttcctcagtcagctccaagccctgtcgcagaagcagtggcgcctaaagttgcggct
gatgtgaagagagagactcccgttttgaaggctccagtcaagaagccgaaaaaacgccat
ttgagagctagatacaaggttatgttcttagccattctcttggtttttgcagccttcttc
ttcttgctctataaaagtcctgccaatactacggtaccagatgtagcaggtcaaacagtg
gcggaagcccgttcgaccattactgctaaaggcctcgaagtaggggaaatcaaagaagac
tacagtgataatgtggcagaaggcaaggtcatcaagactgatccgccagtaaatagccag
cgtcgggaaaatagtaaggtggatttgattgtatctaaaggttcaaaaacctttacggta
gaaaactatgttggtcaaaaatcttctgaagcggtcgaacatctgaagagcacttacaat
atccctgaaaagctaatcaagattgtagaagaagaaaattctgatgttgaagagggagtt
gttatcagccagacaccggctgcaggttcttcttacgatgtgacatcaaacaaacagatt
accctgacggttgctaaaacggtaactagagttgaaatgcctgactttggccatctccaa
gtttcctatgcttatgcacgggcctatctgatggagatgggaatttctgcgtctcgaatc
gagcgtgttatcgatcgttctgtagagtcaagtcaagctgatttggtgacatcccagtct
ccagcagctggacaaagtatcaaattgaaatcaaataccaagattactttctacgtaaca
gatggcacagtcactagctcttctagttcaagtgagcgaacacaaccatcatcttcttca
agcagcacgagtgaggaggaaagtcactcgagctcttcgagcagctctacaactgcatcg
acgagccattaa

DBGET integrated database retrieval system