KEGG   Streptococcus cristatus: I872_08995Help
Entry
I872_08995        CDS       T02649                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
soi  Streptococcus cristatus
Pathway
soi00220  Arginine biosynthesis
soi00250  Alanine, aspartate and glutamate metabolism
soi00290  Valine, leucine and isoleucine biosynthesis
soi01100  Metabolic pathways
soi01110  Biosynthesis of secondary metabolites
soi01130  Biosynthesis of antibiotics
soi01210  2-Oxocarboxylic acid metabolism
soi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:soi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    I872_08995
   00290 Valine, leucine and isoleucine biosynthesis
    I872_08995
   00220 Arginine biosynthesis
    I872_08995
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:soi01007]
    I872_08995
Enzymes [BR:soi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     I872_08995
    2.6.1.66  valine---pyruvate transaminase
     I872_08995
Amino acid related enzymes [BR:soi01007]
 Aminotransferase (transaminase)
  Class I
   I872_08995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 MHC_II_alpha Cys_Met_Meta_PP Spherulin4
Motif
Other DBs
NCBI-ProteinID: AGK71879
UniProt: N0CFU8
LinkDB All DBs
Position
complement(1817465..1818679)
Genome map
AA seq 404 aa AA seqDB search
MKEFNKSSKLEHVAYDIRGPVLEEAMRMRANGEKILRLNTGNPAEFGFTAPDEVIHDLIM
NARDSEGYSDSKGIFSARKAIMQYCQLKKFPSVDIDDIYLGNGVSELIVMSMQGLLDDGD
EVLVPMPDYPLWTAAVSLAGGNAVHYVCDEQAEWYPDIDDIKSKITSNTKAIVIINPNNP
TGALYPDDLLLEIVEIARQNNLIIFADEIYDRMVMDGHVHTPVASLAPDLFCVSMNGLSK
SHRIAGFRVGWMVLSGPKKHVKGYIEGLNMLSNMRLCSNVLAQQVVQTSLGGHQSVDELL
LPGGRIYEQRNFIYNAIQDIPGLSAVKPKAGLYIFPKIDREMYRIDDDEQFVLDFLKQEK
VLLVHGRGFNWQEPDHFRIVYLPRVDELAQIQEKMTRFLRQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatttaataagtccagtaaattggagcatgtagcctatgatattcgtggacca
gttttggaagaagcgatgcggatgcgagctaatggagaaaaaattctccgcctgaacaca
ggaaatccagctgagtttggttttaccgctccagacgaggtcattcatgatttgattatg
aatgcgcgtgatagtgagggctactctgattctaaggggattttctcagcccgtaaggcg
attatgcagtattgccagctcaagaagtttccaagtgtggatatcgatgatatttatctg
ggaaatggagtcagcgagctaattgtcatgtccatgcagggcttacttgatgacggggac
gaggtgctggtgccgatgccagattacccgctctggacggcggcagtcagtctggctggt
gggaatgctgttcactatgtctgtgatgagcaggcagaatggtatccagatattgacgac
atcaagtcaaaaatcacctctaataccaaggctatcgttatcatcaatcctaacaatcca
acaggggcactgtatcctgacgaccttttgttagaaattgtggaaattgcgcgccaaaat
aatctcattatcttcgcggacgaaatctacgaccgcatggtcatggatgggcatgtccat
acgccggttgctagtctggctcctgacctcttctgtgtcagcatgaatggtctttccaag
tcccaccgaatcgcaggtttccgggttggttggatggtgctatctggtcctaagaagcat
gttaagggctatatcgaagggctaaatatgctctccaatatgcgcttgtgctccaacgtc
ttggcccagcaggttgtgcaaacatcgcttggaggtcaccagtcggtggatgaattgctt
ttgccaggcggtcgtatctatgaacaaagaaacttcatttacaatgccattcaagatatt
ccaggtttgtctgcagtcaaacctaaggcgggtctttacatcttcccgaaaattgatcga
gaaatgtaccgtatcgatgatgatgagcagtttgtcttggatttcctcaagcaggaaaaa
gtccttcttgtccatggccgaggctttaactggcaagaaccagatcatttccggattgtc
tatctgccacgggtggatgagctagctcagatccaagaaaaaatgacgcgcttcctgcgc
caataccgcagataa

DBGET integrated database retrieval system