KEGG   Solimonas sp. K1W22B-7: D0B54_00670Help
Entry
D0B54_00670       CDS       T05591                                 

Definition
(GenBank) penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
sok  Solimonas sp. K1W22B-7
Pathway
sok00550  Peptidoglycan biosynthesis
sok01100  Metabolic pathways
sok01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:sok00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    D0B54_00670
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    D0B54_00670
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sok01003]
    D0B54_00670
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sok01011]
    D0B54_00670
Enzymes [BR:sok01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     D0B54_00670
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     D0B54_00670
Glycosyltransferases [BR:sok01003]
 Polysaccharide
  Bacterial polysaccharide
   D0B54_00670
Peptidoglycan biosynthesis and degradation proteins [BR:sok01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   D0B54_00670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: AXQ27291
UniProt: A0A346MVF4
LinkDB All DBs
Position
128673..131078
Genome map
AA seq 801 aa AA seqDB search
MKWKLLLSVLAGLLLAGVLALWGGFLVAKAYFEDELPSVDALRQLQLAIPLRIYSADGKL
LGEFGAERRAPLKYREFPPRVVQAFLAAEDDRFFEHPGVDWMGLVRAAFSLAATGQKSQG
GSTITMQLARNVFLSNERSYGRKFKEILLSLRIEKELKKEEILELYLNKIYLGERAYGVG
AAAMTYFSKNIKDLKISEAAVMAGLPKAPSRDNPIVNPERAKERRNYVLRRMHELGYISA
EEFKAGLEEPLIVKPYRARAEVDAYYVAEMVRQEILTRYGDTAYTNGFYVTTTIDSTRQN
AANAALRKAINDYGERHGWRGPEAKLDPALLAPGQEQKLVDALDARPQVASLVPVVVLGY
SPQKLVLRGRDGDLEMPPEGFKWAAFSAKRTPAIGDVLRIRAGGKEGREWVLAQLPQAQG
ALVALNPRDGAIVALVGGYDFFQGKFNRVTQARRQAGSGFKPFLYAAAMARGYSPASVFL
DAPVVFSIRGQQDWRPENYGGDFKGPMTLREALVQSRNLVSIRVLQAIGIDYAREYIARF
GLPIEHMPRNLTMSLGTGDFTPLEMARGFSTIANGGYLTEPYFIDSISDGAGKLLFKAQP
KIACYECEELPPPPEMASDDPSANEAEAPPPDIPENGAPRVIDPQTVWMITDILHDVTVR
GTAAKVNELGRADLAGKTGTTNDETDAWFNGFQKTLVATAWVGRDQPGPLGKGEVGGRAA
LPMWLDFMRVALKDVPQGMRPRPSGLVSVRIDSRSGKLASGDGEGVFEVVPQDRIPEAAD
SPPGLEEEGAKPSSGGVEELF
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggaagctgttgctgtcggtcctggcgggactgctgctggccggcgtgcttgcg
ctctggggcggattcctcgtggccaaggcctatttcgaggacgaactgccctctgtggac
gccctgcgccagctgcagctggccatcccgctgcgcatctattccgctgacggaaagctg
ctcggcgagttcggcgccgagcgccgcgcgcccctcaagtacagggagtttccgccgcgg
gtggtgcaggccttcctggctgccgaggacgaccgtttcttcgagcatcccggcgtggac
tggatgggcctggtgcgcgcggccttcagcctggccgccaccgggcagaaatcccagggt
ggcagcaccatcaccatgcagctggcgcgcaacgtgttcctctccaacgagcggagctac
ggtcgcaagttcaaggagatcctgctgtcgctgcgcatcgagaaggagctgaagaaggag
gaaatcctcgagctctatctcaacaagatctacctgggcgagcgcgcctacggcgtcggc
gccgccgcgatgacttattttagtaaaaatatcaaggacttgaagatatcggaggcagcg
gtgatggcgggcctgccgaaagccccgtcgcgcgacaacccgatcgtcaatccggagcgg
gccaaggagcggcgcaactacgtgctgcgccgcatgcacgagctgggctacatctcggcc
gaggagttcaaggcggggctggaagagcccctgatcgtcaagccctaccgcgcgcgggcc
gaggtcgacgcctactacgtcgcggagatggtgcgccaggagatcctgacccgctacggc
gacaccgcttacaccaacggcttctacgtcaccaccacgatcgactccacccgccagaac
gctgccaacgccgcgttgcgcaaggccatcaacgactacggcgagcgccacggctggcgc
gggccggaggccaagctcgatccggcgctgctggcgcccgggcaggagcagaagctggtg
gacgccctggatgcgcgcccgcaggtggccagcctggtgccggtggtggtgttgggctat
tcgccgcagaagctggtcttgcgcggccgcgacggcgacctcgagatgcccccggaaggt
ttcaagtgggccgccttcagcgccaagcggacgccggcgatcggtgacgtcctgcgcatc
cgtgctggcggcaaggagggtcgcgaatgggtcctggcacagctgccgcaggcccagggc
gccctggtcgccctgaacccgcgcgatggcgccatcgtcgccctggtcggcggctacgat
ttcttccagggcaagttcaaccgcgtcacccaggcacggcgccaggccggatccggcttc
aagcctttcctgtacgccgccgcgatggcgcgcggctactcgccggcttcggtattcctc
gacgccccggtggtgttcagcatccgcggccagcaggactggcgcccggagaactacggt
ggcgacttcaagggcccgatgaccctgcgcgaagccctggtgcagtcgcgcaacctggtg
tcgatccgcgtgctgcaggccatcggcatcgactacgcccgcgaatacatcgcccgcttc
ggcctgccgatcgagcacatgccacgcaacctgacgatgtcgctgggcaccggcgacttc
acgccgctggagatggcgcgcggcttctccaccatcgccaacggcggttatctcaccgag
ccctatttcatcgacagcatcagcgacggtgccggcaagctgctgttcaaggcgcagccg
aagatcgcctgctacgaatgcgaagaactgccgccgccgcccgaaatggccagcgacgat
ccttccgccaacgaggccgaggcgccgccgccggacattcccgagaacggtgcgccgcgc
gtgatcgatccgcagaccgtctggatgatcaccgacattctccacgacgtgaccgtgcgc
ggcaccgccgccaaggtcaacgaactgggccgcgccgacctggccggcaagaccggcacc
accaacgacgaaaccgacgcctggttcaacggcttccagaagaccctggtcgccaccgcc
tgggtcgggcgcgaccagccgggtccgctgggcaagggcgaggtcgggggtcgtgccgcg
ctgccgatgtggctggacttcatgcgcgtggcgctcaaggacgtgccccagggcatgcgg
ccgcgcccctcgggcctggtcagcgtgcgtatcgacagccgcagtggcaagcttgccagt
ggcgacggcgaaggggtgttcgaagtggtcccgcaggaccgcatcccggaggccgccgac
agtcccccggggctggaagaggagggcgccaagccgtcctctggcggggtggaagagttg
ttttga

DBGET integrated database retrieval system