KEGG   Solimonas sp. K1W22B-7: D0B54_03695Help
Entry
D0B54_03695       CDS       T05591                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sok  Solimonas sp. K1W22B-7
Brite
KEGG Orthology (KO) [BR:sok00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    D0B54_03695
Enzymes [BR:sok01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     D0B54_03695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 Glutaredoxin HI0933_like AlaDh_PNT_C Thi4 K_oxygenase FAD_binding_3 DAO NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: AXQ27832
UniProt: A0A346MWZ5
LinkDB All DBs
Position
739868..741451
Genome map
AA seq 527 aa AA seqDB search
MLDADLKEQLKTYLERVTRPIEITANLDGGDASQELRELLNELVALSSQISLREQADASQ
RRPSFTLGTPGQDIHVRFAGIPLGHEFTSLVLALLQVGGHPSRLAQDVIEQVRKLEGDFR
FETYFSLSCQNCPDVVQALNLMAVLNPRIRHVAIDGALFQDEVEQRQVMSVPKIFLNGEV
FGSGRMGVEEILAQVDTGAGAREAEKLKTKAPFDVLVVGGGPGGSAAAIYAARKGIRTGV
AAERFGGQVLDTMGIENFISVKETEGPRLAAALEEHVKTYEVDVMNLQRAEKLLPAGSDG
LIEVQLANGAALKARTVIVSTGARWRQMNVPGENEYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLLEFDSQLRADAVLQRKLHSLPNVRVIVSAQTTEVTGDG
QKLNGLLYKDRASGETHRVELEGVFVQIGLLPNSEWLKDTVALSPRGEIEVDAHGRTSVP
GVFAAGDVTTVPYKQIVIAMGEGSKAALSAFDHLIRTSAPAEEQKAA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgccgatctcaaggaacaactgaagacctatctcgaacgggtcacgcgtccc
atcgagatcaccgccaacctcgacggcggtgacgcctcgcaggaactgcgcgaactgctg
aacgagctggtcgccctgtcgtcgcagatcagcctgcgcgagcaggccgacgcgtcgcag
cgcaggccctcgttcacgctcggcacgccggggcaggacatccacgtccgcttcgccggc
atcccgctgggccacgagttcacttcgctggtgctggccctgctgcaggtcggcggccac
ccctcgcgcctggcgcaggatgtcatcgagcaggtgcgcaagctggaaggcgacttccgc
ttcgagacctacttctccctgtcctgccagaactgcccggacgtggtgcaggcgctcaac
ctgatggccgtgctcaacccgcgcatccgccacgtcgccatcgacggcgccctgttccag
gacgaggtcgagcagcgccaggtcatgtccgtgcccaagattttcctcaacggcgaggtc
ttcggctccggccgcatgggcgtggaggaaatcctcgcccaggtcgacaccggtgccggc
gcgcgcgaggccgaaaagctcaagaccaaggcgccgttcgacgtgctggtggtgggcggc
ggccccggcggctccgcggcggcgatctacgccgcgcgcaagggtatccgcaccggcgtc
gccgccgagcgcttcggcggccaggtgctggacaccatgggcatcgagaacttcatctcg
gtgaaggaaaccgaagggccgcgcctggccgcggcgctggaggagcacgtcaagacctac
gaggtcgacgtgatgaacctgcagcgcgccgagaagctgctgcctgccgggtctgacggc
ctgatcgaagtgcagctggccaacggcgccgcgctcaaggccaggaccgtgatcgtctcc
accggcgcccgctggcgccagatgaacgtgcccggcgagaacgagtaccgcaacaagggc
gtggcctactgcccgcactgcgacggcccactgttcaagggcaagcgcgtcgccgtgatc
ggcggcggcaactccggcgtggaggccgccatcgacctcgccggcatcgtcgcccacgtc
acgctgctggagttcgacagccagctgcgcgccgacgccgtgctgcagcgcaagctccac
agcctgcccaacgtgcgcgtcatcgtctccgcccagaccaccgaggtcaccggcgacggc
cagaagctcaacggcctgctctacaaggaccgcgccagcggcgagacgcatcgcgtcgag
ctggaaggcgtgttcgtgcagatcggcctgctgcccaacagcgaatggctcaaggacacc
gtggccctgtcgccgcgcggcgagatcgaggtcgacgcccatggccgcacctcggtgccc
ggcgtgttcgccgccggcgacgtcaccaccgtgccctacaagcagatcgtcatcgccatg
ggcgaaggctccaaggccgcgctctcggccttcgaccacctgatccgcacgtccgcgccg
gcggaggagcagaaggcggcgtaa

DBGET integrated database retrieval system