KEGG   Solimonas sp. K1W22B-7: D0B54_15240Help
Entry
D0B54_15240       CDS       T05591                                 

Gene name
gstA
Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sok  Solimonas sp. K1W22B-7
Pathway
sok00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sok00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    D0B54_15240 (gstA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sok02000]
    D0B54_15240 (gstA)
Enzymes [BR:sok01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     D0B54_15240 (gstA)
Transporters [BR:sok02000]
 Other Transporters
  Pores ion channels [TC:1]
   D0B54_15240 (gstA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_3 GST_C_2 GST_N_2 GST_C_3 GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: AXQ29949
UniProt: A0A346N312
LinkDB All DBs
Position
3395708..3396319
Genome map
AA seq 203 aa AA seqDB search
MKLYFAPGACSLSPHIVLHEAGIAAETEKVDLASKKTASGADFASINPKGYVPALQLDDG
TLLTEGPAIVQYLADQRPASKLAPENGTLPRYQLQSLLNFISTEIHKSYSPLFRPTTVPE
ARQVAIDNLQKRYDTVEEMLANRQYITGEQFTVADAYLFTVTNWSRVVKVDLFSTRPNLV
AYMERVGGRPAVQSAMRAEGLIK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtacttcgcccccggtgcctgctccctctcgccgcatatcgtgctgcacgag
gccggcatcgccgctgaaaccgaaaaggtggacctggccagcaagaagaccgcctccggg
gctgactttgccagcatcaatcccaagggctacgtcccggcgctgcagctggacgatggc
acgctgctgaccgagggcccggccatcgtgcagtacctggccgaccagcgcccggcatcg
aagctggcgccggagaacggcacgctgccgcgctaccagctgcagtcgctgctcaacttc
atcagcaccgagatccacaagagctacagcccgctgttcaggccgaccacggtgccggaa
gcccggcaggtggcgatcgacaacctgcagaagcgctacgacacggtcgaggagatgctg
gcgaaccgccagtacatcaccggcgagcagttcaccgtggccgacgcctacctcttcacc
gtgaccaactggagccgcgtggtgaaggtggacctgttctcgacgcggccgaacctggtg
gcgtacatggagcgcgtgggcggccggccggcggtgcagagcgcgatgcgagcggaaggc
ttgatcaagtag

DBGET integrated database retrieval system