KEGG   Saccharolobus solfataricus 98/2: Ssol_0074Help
Entry
Ssol_0074         CDS       T02126                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sol  Saccharolobus solfataricus 98/2
Pathway
sol00620  Pyruvate metabolism
sol00680  Methane metabolism
sol00720  Carbon fixation pathways in prokaryotes
sol01100  Metabolic pathways
sol01120  Microbial metabolism in diverse environments
sol01200  Carbon metabolism
Module
sol_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ssol_0074
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ssol_0074
   00680 Methane metabolism
    Ssol_0074
Enzymes [BR:sol01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Ssol_0074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ACX90375
UniProt: D0KUQ4
LinkDB All DBs
Position
64368..65903
Genome map
AA seq 511 aa AA seqDB search
MRIIPRTMSTQHPDNAKVPEWAKSEVIEGEDEVKEAFLAYSMYGVHEVMWDAEGKDVDTH
VVRKLLSNYPDYFREHILGKDLFLTYRLPNPKVEGADRKVFAETMESIPITYDLAEKFYG
NGITIPVFEVILPMTTSSLEIISVARYYEKAVANEDELELYDGVKVKDLVGEIYPKVIEV
IPLVEDRDSLQNINNIVEGYYKVIKPKYMRVFLARSDPAMNYGMITAVLSVKIALSELYK
LSESLNFEIYPIIGVGSLPFRGHLSPENYEKVLEEYKGVYTYTIQSAFKYDYDYDKVKSA
ISSINNSRISPARILEKYEEDVLRKITILYTERYQPIIESLANAINDVSVLLPRRRARKL
HIGLFGYSRSAGKVSLPRAISFVGSLYSIGIPPELIGISSLSNLDEKEWDIFKQNYVNFK
HDLQTAARFLNWESFKLIKDIWKISEDTIAKIKEDIDYAESVIGIKLGGIDYDSRKHILM
SSLFLLSFKEKILQESKKYLYEMALIRRSLG
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcataccacgcactatgtcaacacaacatcccgataatgcaaaagtaccagag
tgggcaaaaagcgaagttattgaaggagaagacgaagttaaagaagccttcctagcttat
agtatgtatggagttcatgaggtaatgtgggatgctgagggaaaagatgtagatactcat
gtggtaagaaagttattgtcaaattatccagactactttagagaacatattttaggtaaa
gatctgtttctaacttataggttacctaacccaaaggtggaaggtgctgatagaaaagtt
tttgccgaaaccatggagagtattccaataacttatgatttggcagagaaattttacggt
aatgggattacgataccagtttttgaagtaattttaccaatgacaactagtagtttagag
ataataagtgtggctaggtattacgaaaaggcagttgcaaatgaagatgaactagaactt
tacgatggtgtaaaagtaaaggatttagttggagaaatatatcctaaagtaatagaagtt
ataccactagtcgaagatagggactctcttcaaaatattaacaatatagtggaggggtat
tataaggtaattaaacctaagtatatgagagtctttttagccagatcggatccagcaatg
aattatggaatgataacagctgttctgtcagtaaagattgccttaagcgagttatacaaa
ctttcagaatcgttaaactttgaaatatatccaataattggtgttggttcacttccattt
agaggtcatttatctcctgaaaactatgaaaaagtattggaagagtataagggagtttat
acatatacgattcaatcagcgtttaagtatgactatgattacgacaaagtaaaaagtgct
atttcttcaataaataactcaaggattagcccagctagaatattggaaaagtatgaggag
gatgttctaagaaagataacgatcttatatactgaacgttaccagccaattatagaaagt
cttgcaaacgctataaatgacgtctccgtgttacttcctagaagaagggccagaaaactt
catattggtctttttggatattctagaagcgcaggcaaggttagcttacctagggcaatc
tctttcgtgggttcattatattcaataggaataccaccagaactaataggaatttcgtct
ttaagcaatttagatgagaaagaatgggatatattcaaacagaattacgttaattttaaa
catgatctacaaactgctgcgagattccttaattgggagtcgttcaaattaattaaggat
atatggaaaattagtgaggatactatagcaaagatcaaggaagatatcgattacgctgag
agcgtgataggcataaaattaggcggcatagattacgatagtagaaaacacatcctaatg
tcttcgctatttttactatcatttaaagagaaaatacttcaagaatctaagaagtattta
tatgagatggcattaattagaagatccttgggatga

DBGET integrated database retrieval system