KEGG   Shewanella oneidensis: SO_0956Help
Entry
SO_0956           CDS       T00099                                 

Gene name
ahpF
Definition
(RefSeq) alkyl hydroperoxide reductase flavoprotein component AhpF
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
son  Shewanella oneidensis
Brite
KEGG Orthology (KO) [BR:son00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SO_0956 (ahpF)
Enzymes [BR:son01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SO_0956 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored Glutaredoxin DAO Thi4 NAD_binding_7 FAD_binding_3 AlaDh_PNT_C K_oxygenase Spermine_synth FMO-like NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 1168802
NCBI-ProteinID: NP_716585
UniProt: Q8EI88
LinkDB All DBs
Position
complement(991215..992798)
Genome map
AA seq 527 aa AA seqDB search
MLDANLKNQLQTYLQNLKRPVELVVSADESKKSQELKSLVNDIVSLSTFVSLKEAQGQRT
PAMTVVNPALNTQISFAGLPMGHEFTSLVLALLHSGGHPIKLSDDIIEQIRNLPGKYEFE
TYVSLTCQNCPDVVQALNMMAAINPNITNVMIDGALFQDEVASRNIMAVPSVYLNGEVFA
AGRISIGEILNKLDTGAASRKAEELSQKAPYEVLVVGGGPAGAAAAIYAARKGLRTGIVA
DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVRDYEVDIMDNQKAVKLASDGLFELE
LASGAKLRSRTVLLATGARWREMNVPGEKEYRGKGVAYCPHCDGPLFKGKRVAVIGGGNS
GIEAAIDLANIVEHVTVLEFDSKLRADDVLQRKAASMGNIKIITQAMTTEVTGDGTRVNG
LNYTDRATGESHHIALAGIFVQIGLVPNAEWLKGTVDLTPRGEIIVDERGQTSVPGVFAA
GDVTNSPYKQIIIAMGSGANASLGAFDYLIRHSDDSTETKTTDTKAA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcgaatttaaaaaatcaactgcaaacctatctgcaaaacctcaagagacca
gttgaacttgtcgtgtcagcagatgaaagcaagaagtctcaagaattaaaaagcttagtc
aatgacatcgttagcctttcaacgttcgtgagcctgaaagaagctcaaggccaacgcacg
ccagcgatgacagtggttaaccctgcactcaatactcagattagctttgctggtctgcct
atgggtcacgaatttacctcactggtgttagccttgctgcacagcggtggacacccgatc
aaactcagcgatgacatcatcgagcagatccgtaatctgcccggcaaatatgagtttgaa
acctatgtgtcactcacctgccaaaactgccctgatgtagttcaagcactcaatatgatg
gctgccattaatccgaacatcaccaacgtgatgatcgacggcgccctgttccaagatgaa
gtcgccagccgcaacatcatggccgtaccttctgtgtacttaaacggcgaggtgtttgcc
gcaggtcgcatcagcatcggtgagatcttaaataaactcgatactggcgctgccagccgt
aaagccgaagagcttagccaaaaagccccatatgaagtcttagtcgttggcggcggccct
gctggcgctgcggcagcaatttacgctgcccgtaaaggcctgcgtaccggtattgttgcc
gacaaattcggtggtcaagtggctgaaaccgttggtatcgaaaactttatttcggtaaaa
gcgactgaaggtccaaaactggtggcaaaccttgaagcccatgtgcgtgactatgaagtc
gacatcatggataaccaaaaggcagtcaaactggcgagcgatggcttattcgaactcgaa
ttagcaagcggcgccaaactgcgtagccgtactgtattactcgcaaccggtgctcgctgg
cgcgaaatgaacgtccccggcgagaaagaataccgtggtaaaggcgttgcctattgccca
cattgtgacggcccattatttaaaggcaaacgtgtagcggttatcggtggcggtaactca
ggtatcgaagcagccatcgacttagccaatatcgttgagcatgtgaccgtactcgagttt
gatagcaaactgcgcgctgacgatgtactgcaacgtaaagcggcctctatgggtaacatc
aaaatcattacccaagcgatgaccactgaagtgactggtgatggtacccgtgttaacggc
ctaaactacaccgaccgcgcaacaggtgaaagtcatcatatcgcgctggcagggatcttc
gtacagatcggtttagtgcccaatgccgaatggttaaaaggcacagtggatttgactcct
cgcggcgaaatcattgtcgatgagcgcggccaaacctcagtacctggcgtatttgccgct
ggtgacgtgaccaactcaccttacaagcaaatcatcattgctatgggtagtggtgccaat
gcctcactgggtgcatttgattacttaattcgccatagcgatgatagtaccgaaaccaaa
accacagacactaaagcggcttaa

DBGET integrated database retrieval system