KEGG   Shewanella oneidensis: SO_1164Help
Entry
SO_1164           CDS       T00099                                 

Gene name
dacA
Definition
(RefSeq) D-alanyl-D-alanine carboxypeptidase DacA
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
son  Shewanella oneidensis
Pathway
son00550  Peptidoglycan biosynthesis
son01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:son00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SO_1164 (dacA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:son01002]
    SO_1164 (dacA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:son01011]
    SO_1164 (dacA)
Enzymes [BR:son01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SO_1164 (dacA)
Peptidases [BR:son01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   SO_1164 (dacA)
Peptidoglycan biosynthesis and degradation proteins [BR:son01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   SO_1164 (dacA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 CytoC_RC
Motif
Other DBs
NCBI-GeneID: 1168993
NCBI-ProteinID: NP_716789
UniProt: Q8EHQ3
LinkDB All DBs
Position
complement(1206370..1207545)
Genome map
AA seq 391 aa AA seqDB search
MMNFVKSPIKTLLLISSVSLPVYAAQPIVTPDAPTVAAKAYVLMDYYSGQIIAEENAYES
LNPASLTKMMTSYVIGQEIKAGNVSPDDDVTISKNAWSKNFSDSSKMFIEVGKTVKVSDL
NRGIIIQSGNDACVAMAEHIAGTEGAFVDMMNSWSKQLGMRDSYFENSHGLDSENHKTTA
YDMALLGAALIRDVPEEYRIYSEKYYTFNGIKQYNRNGLLWDNSMNVDGIKTGHTSGAGY
NLVASATKDGMRLISVVMGTQSEAARKAESKKLLTYGFRFFETVTPYKAGDSFVTQQIWY
GDKSTVDLGVATDTPITVSRGRAKDLKANFELTKPLDAPLKKGETVGRLYFQLDGKDIAQ
FPLVTLQEVNEGSWFSKLVDYFKQLFSGWFS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgatgaattttgtaaaaagtcccattaagacattgctgctaatttcgagtgtttctctt
cctgtttatgctgcgcagccgattgttacccctgatgcaccaaccgttgccgccaaggct
tacgtcttgatggattattattcaggccaaatcattgccgaagaaaatgcctacgaaagc
ttaaaccctgccagcttaaccaaaatgatgaccagttatgtcattggtcaggaaattaaa
gcaggtaacgtttcccccgatgatgatgtcaccatcagtaaaaatgcttggtcaaaaaac
ttctctgactcatcaaaaatgttcatcgaagtgggtaaaaccgtaaaagtatccgattta
aaccgcgggatcatcatccaatcaggtaacgatgcctgtgtggcgatggcggaacatatc
gcaggcaccgaaggcgctttcgtcgacatgatgaactcatggtcaaaacagctaggaatg
cgtgatagctattttgaaaactcccacggacttgattcagaaaaccacaaaacgaccgcc
tatgatatggcgcttttaggcgcggcactgatccgcgacgtacctgaagaatatcgcatc
tacagcgaaaaatactataccttcaatggcatcaagcaatataaccgcaacggcctgttg
tgggataacagcatgaatgtggatggtatcaaaaccggtcacacctctggcgcgggttat
aacttagtcgcgtcagccacaaaagacggtatgcgtttaatttcggttgttatgggtact
caaagtgaagccgcccgtaaagcagaaagtaaaaaactgctcacctatggtttccgcttc
ttcgaaactgttactccatacaaggctggtgacagcttcgttacccaacaaatttggtac
ggcgataaaagcactgtggatttaggtgtcgcgaccgatacaccaatcaccgtcagccgt
ggccgcgcaaaagacttgaaagcaaacttcgagctgactaagccactcgatgcgccactg
aaaaaaggcgaaaccgtgggccgcttatacttccagttagatggtaaagatattgcacaa
ttcccactggtcaccttacaagaagtcaacgaaggcagctggttcagtaaattagtcgat
tactttaagcaactgttttctggttggtttagctaa

DBGET integrated database retrieval system