KEGG   Shewanella oneidensis: SO_1198Help
Entry
SO_1198           CDS       T00099                                 

Gene name
folP
Definition
(RefSeq) dihydropteroate synthase FolP
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
son  Shewanella oneidensis
Pathway
son00790  Folate biosynthesis
son01100  Metabolic pathways
Module
son_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:son00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SO_1198 (folP)
Enzymes [BR:son01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SO_1198 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-GeneID: 1169026
NCBI-ProteinID: NP_716823
UniProt: Q8EHM1
LinkDB All DBs
Position
1241974..1242807
Genome map
AA seq 277 aa AA seqDB search
MFELISGTKRLSLASPVVMGILNVTPDSFSDGGKFSSFELACQHADEMVAQGALIIDIGG
ESTRPGAADVGVEDELARVIPLVEYVAKHHDVWISVDTSKPEVMRQAVNAGAHLINDVRA
LLEPGALETAAQLNVPICLMHMQGAPRTMQAAPEYHDLVADVSEFLNERIQACLEAGIPR
ERLLIDPGFGFGKTLAHNYELLAKLETFTQFELPILIGLSRKSMIGNLLARPTSERLAGS
LAGAMIAAQKGAHIIRVHDVPETVDMLKVLQATQAYY
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgaattaatttctggaaccaaacgcttatccttagcttcgcccgtagtgatgggc
attctgaatgtcactcccgattctttttccgacggtggaaagttctcttcctttgaatta
gcttgccagcatgccgatgagatggtcgctcaaggagcgctcatcattgatatcggcggc
gagtcaacaagaccaggggcggctgatgtcggcgttgaggatgagctcgctcgtgtgatc
ccgctggtagagtatgttgccaaacaccatgatgtgtggatttcggtcgataccagtaag
cccgaagtgatgcgacaggcggtgaatgccggtgcccatttaattaatgatgttcgcgcg
ttattggagcctggtgcattagagactgcggcgcagctgaatgtacctatatgtttgatg
cacatgcagggagcgccacgcactatgcaagcggcacccgaatatcacgacctagttgct
gatgtctctgaattcctaaacgagcgtattcaagcctgtctcgaggcagggatcccgcgg
gagcggttgttaatcgacccaggcttcggctttggtaaaactttagcgcataactatgaa
ttgctagcaaagttagagacttttactcagtttgaactgccaatcttgataggtttatcc
cgtaagagcatgataggaaatcttcttgctaggccgacctccgagcgccttgcgggaagc
cttgctggcgctatgatagcggcccagaaaggggcacatatcattcgtgtccatgatgtc
cctgaaacagttgatatgctcaaagtgttacaagcgacacaggcatattactag

DBGET integrated database retrieval system