KEGG   Shewanella oneidensis: SO_1769Help
Entry
SO_1769           CDS       T00099                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
son  Shewanella oneidensis
Pathway
son00250  Alanine, aspartate and glutamate metabolism
son00410  beta-Alanine metabolism
son00430  Taurine and hypotaurine metabolism
son00650  Butanoate metabolism
son01100  Metabolic pathways
son01110  Biosynthesis of secondary metabolites
son01120  Microbial metabolism in diverse environments
son02024  Quorum sensing
Module
son_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SO_1769
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SO_1769
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SO_1769
   00430 Taurine and hypotaurine metabolism
    SO_1769
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    SO_1769
Enzymes [BR:son01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SO_1769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS
Motif
Other DBs
NCBI-GeneID: 1169543
NCBI-ProteinID: NP_717379
UniProt: Q8EG41
LinkDB All DBs
Position
complement(1847735..1849384)
Genome map
AA seq 549 aa AA seqDB search
MTQKLPRQATASEESLMRIFTVPEDADSTLSIIEQKLSEDLAGFLGDSIAALEKPLSEIE
TDFQTFEIPNQPRFVSDYTDEIMQNLVAHSVHTAAPSFIGHMTSALPYFVLPLSKMMVGL
NQNLVKIETSKAFTPLERQVLGMMHHLIYAQHDDFYRNWMHSANHSLGAFCSGGTVANIT
ALWIARNQLLKADGDFKGVTREGLIKALRHYDYDDLAILVSERGHYSLGKAVDLLGIGRD
NIISIPTDADNKVDVTQMRKIAVELAHKRIKVMAIVGVAGTTETGNIDPLKQLAALASEL
NCHFHVDAAWGGASLLSNKYRHLLDGVELADSVTIDAHKQMYVPMGAGMVLFKNPEFAHA
IAHHAEYILRRGSKDLGSQTLEGSRPGMAMLVHACLQIIGRDGYEILINNSLEKARYFAE
QIDAHPDFELVTAPELCLLTYRYVPASVQAAMQVAIEQGDKAKLERFNEQLDGLTQFIQK
HQREQGKSFVSRTRIQPARYFRQPTVVFRVVLANPLTSHEILNQVLIEQGEIATLDKEFL
PALLAMVAE
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaaaactccctcgccaagccaccgcgtctgaagaaagcctgatgcggattttc
actgtgcccgaagatgcagattccaccttaagcattatcgagcagaagctttccgaggat
ttagcaggctttttgggtgacagtattgccgcgctagaaaagccgctatcagagatcgaa
accgattttcaaacctttgaaattccaaaccagccgcgttttgtctccgactataccgac
gaaatcatgcaaaacttggtggcgcattcggtgcatacggcggcgccgagttttattggc
catatgacctcggcattgccctattttgtgttgccactgtcgaaaatgatggtggggctg
aatcaaaacttggtcaaaatcgaaacgtccaaggcttttaccccgcttgagcgccaagtg
ctcgggatgatgcatcatttaatttacgctcaacacgatgatttttatcgtaattggatg
cacagcgccaatcattcccttggcgcattttgctccggcggcacggtcgctaacatcacg
gccctgtggattgcccgtaaccaattacttaaggccgatggcgactttaaaggcgtcacc
cgcgaaggcttaatcaaggcgctgcgtcactatgactatgatgatttagcgattcttgtc
tccgagcgcggtcactattcattaggtaaagcagtcgatctgctcggtattggtcgcgac
aatatcatcagtatcccaaccgatgctgataacaaggttgatgtcacccaaatgcgtaag
atcgcagttgaacttgcacataaacgcattaaagtcatggcgattgtgggtgtggctggc
acaacagagacgggcaatatcgacccgcttaagcagcttgcggcattagcaagtgagtta
aactgtcacttccatgtggatgcggcttggggcggcgcgagcttattatccaataaatac
cgccatttactcgatggtgttgaactcgcagattcggtcaccatcgatgcccataagcaa
atgtatgtccccatgggcgcgggtatggtgctatttaaaaatcctgagtttgcccatgcg
attgcccaccacgccgaatatattttgcgccgaggctccaaggatttaggcagccaaacg
cttgaaggctcacgccccggcatggcgatgttagtgcatgcctgcttacagattatcggt
cgcgatggctacgaaattcttatcaataacagccttgaaaaagcgcgttattttgccgag
caaatcgacgcgcaccccgattttgagttagtcaccgcgccagagctgtgcctgctcacc
tatcgttatgttccagcgagtgtgcaggcggcgatgcaagtggcgattgaacaaggtgat
aaagcaaagcttgagcgctttaatgagcaactcgatggcctgacccaatttattcaaaaa
caccagcgcgaacagggcaaatcctttgtctcgcgcacccgcattcaacccgcccgctac
tttagacaacccacagtggtgtttcgcgtcgtattagctaatcccttgactagccatgag
attctgaatcaagtgcttatcgagcaaggcgaaattgccacattggataaagagttttta
cccgcactattagctatggtcgctgaatag

DBGET integrated database retrieval system