KEGG   Shewanella oneidensis: SO_2217Help
Entry
SO_2217           CDS       T00099                                 

Gene name
ddlA
Definition
(RefSeq) D-alanine--D-alanine ligase DdlA
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
son  Shewanella oneidensis
Pathway
son00473  D-Alanine metabolism
son00550  Peptidoglycan biosynthesis
son01100  Metabolic pathways
son01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:son00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SO_2217 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SO_2217 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    SO_2217 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:son01011]
    SO_2217 (ddlA)
Enzymes [BR:son01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SO_2217 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:son01011]
 Precursor biosynthesis
  Amino acid ligase
   SO_2217 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp RimK
Motif
Other DBs
NCBI-GeneID: 1169954
NCBI-ProteinID: NP_717814
UniProt: Q8EEZ2
LinkDB All DBs
Position
complement(2331691..2332701)
Genome map
AA seq 336 aa AA seqDB search
MSKINLLLLCGGGSAEHDISLLSANYFETSLAKSEQFNVLRVVLDKFGQYQTAAGDDCEL
TNNREIRFRDESKAPWPVDYVIPCIHGYPGETGDIQSYFNLIQLPYFGCESEASSNCFNK
ITAKMWFSALGIPNTPYIFLNQYDDEAIAQTQAALEKWGSIFVKAASQGSSVGCYKVDEA
SKVLGVLKDAFGYAPYVIVEKTIKARELEVAVYEYQGEVIATLPGEIICDSNTFYTFDEK
YAKSSKARTDVVAQNVPTDISDQIRAYAIKAFKGMKLRHLSRIDFFLTADNEILLNEINT
FPGSTPISMFPKMLQNHGHDFTQYLSLVINSQLAAK
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaatcaatttacttttgctgtgcggcggtggaagtgcggaacacgatatttcc
ctactgtcggctaattattttgaaacctcattagcaaaatcagaacagttcaatgtacta
cgtgtggtactggataaatttggccaataccaaaccgccgcaggggatgactgcgagctg
accaataaccgtgagatccgctttcgtgacgagagtaaagccccttggcctgtggattat
gtcatcccttgtattcacggttatccgggcgaaactggtgatattcaatcttactttaat
cttatccaactgccctactttggctgtgagtccgaagccagcagcaactgctttaacaaa
atcactgctaagatgtggttcagcgccttaggcattcccaacacgccttatatcttttta
aatcaatacgatgatgaagccattgcccaaacccaagcggcacttgaaaagtggggatcg
attttcgtcaaagcggcctctcaaggctcctctgtcggttgctataaggtggatgaggcc
agcaaagtgctaggcgtgcttaaagacgcatttggttatgcgccctacgtaattgtcgaa
aaaaccattaaagcccgtgaacttgaagtcgcggtttacgaatatcaaggtgaagtgatt
gccactctacccggcgaaattatctgtgatagcaataccttctacaccttcgatgagaaa
tacgcgaaaagcagcaaggcacgcaccgatgtggttgcgcaaaatgtgccgactgacatt
agcgatcagatccgcgcctatgcgattaaagcctttaagggaatgaaattacgccatctg
tcccgtattgattttttcttaacggcggataatgaaatcctgttaaacgaaatcaatacc
ttcccaggttcaacaccgatttccatgttcccaaagatgctacaaaatcatggacatgac
ttcacccaatacttaagtttggtgattaacagccagttagcggcaaagtaa

DBGET integrated database retrieval system