KEGG   Shewanella oneidensis: SO_2881Help
Entry
SO_2881           CDS       T00099                                 

Gene name
sodB
Definition
(RefSeq) Fe/Mn superoxide dismutase SodB
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
son  Shewanella oneidensis
Brite
Enzymes [BR:son01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SO_2881 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 1170572
NCBI-ProteinID: NP_718453
UniProt: Q8ED83
LinkDB All DBs
Position
3001475..3002059
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKNALEPHISQETIEYHYGKHHNTYVVKLNGLIEGTDFAGKSLEEIIKTS
TGGVFNNAAQVWNHTFYWNCLAPNAGGEPTGPVADAIKAAFGSFDAFKAQFTDSAVNNFG
SAWTWLVKKADGTVAIVNTSNAATPLTDSTVTPILTVDVWEHAYYIDYRNVRPDYLAHFW
QLVNWDFVNQNFAG
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattacccgcattaccatatgcaaagaacgcacttgaaccacacatttct
caagaaaccattgaataccactacggcaagcatcacaacacctacgttgttaagctaaac
ggtttaatcgaaggaaccgatttcgcaggtaaatctttagaagaaatcatcaaaacttct
acaggtggcgtatttaacaacgcagctcaagtttggaaccacactttctactggaactgc
ttagcaccaaacgctggcggtgaaccaacaggccctgtggctgatgctatcaaagcggct
ttcggttcattcgatgcattcaaagcccaatttaccgattcagcggtcaacaacttcggt
agcgcctggacttggttagtgaaaaaagccgatggtactgtcgctatcgttaacactagc
aatgctgcaacacctctgactgacagcactgttaccccaatcctgactgtggatgtgtgg
gaacacgcttactacatcgattaccgcaatgttcgccctgactacttagcccacttctgg
caattagtaaactgggacttcgtgaaccaaaacttcgcaggttaa

DBGET integrated database retrieval system