KEGG   Schaalia odontolytica: FBF35_05180Help
Entry
FBF35_05180       CDS       T05977                                 

Gene name
aroC
Definition
(GenBank) chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
soo  Schaalia odontolytica
Pathway
soo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
soo01100  Metabolic pathways
soo01110  Biosynthesis of secondary metabolites
soo01130  Biosynthesis of antibiotics
soo01230  Biosynthesis of amino acids
Module
soo_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:soo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FBF35_05180 (aroC)
Enzymes [BR:soo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     FBF35_05180 (aroC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt
Motif
Other DBs
NCBI-ProteinID: QCT35457
LinkDB All DBs
Position
1175963..1177174
Genome map
AA seq 403 aa AA seqDB search
MLRWMTAGESHGPALLATIEGLPSGLHVTTEDLRRGLARRRLGYGRGARQKFEADEVSIL
AGVRHGVTTGAPVAIRIGNSEWPKWETVMSADPVDPSELLIDAGTGDEREIARNRPLTRP
RPGHADLPGMLSYDLSEARPVLERASARETAARVALGVLAEALLEQVAGVRLVSHVVSVG
AQHATASSTPTPADEAALCEASMRTLNPEDNARFEAAVDAAKQAGDTIGGVAEVIAYDVP
VGLGTHVTARERLDARLAAALMSIQSVKGVEIGDGFAQAALLGSAAHDEIVRGEDGHLTR
ASNHAGGIEGGTSNGAPIVARAAFKPISTVPHALRSVDLATGEEAVGLHQRSDTCQVVPG
AVIAEAEVALVLADALSDHAGGRSVGEMRRNLEAYLAVVGKRA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgctgagatggatgaccgccggtgaatcacacggacccgcactgctcgcaacgatcgag
ggactgccctccgggttgcatgtgacgacggaggacctgcgccgtggcctcgcacgtcgt
cgcctcggctacggtcgtggcgctcggcagaagttcgaggccgacgaggtgtcgatcttg
gctggcgtgcgtcacggcgtgacaaccggcgccccagtggctattcgcattggtaactcc
gagtggcccaagtgggagacggtgatgagtgccgatccggtcgatccgtcagagcttctc
atcgacgcgggaacgggagacgaacgcgagatcgctcgtaaccggccactgacgaggccc
cgtcccggtcacgcggacctgcccggaatgctgtcctacgacctgtccgaggctcgcccc
gtcctcgagcgcgcgagtgcccgcgagactgccgcgcgcgttgcactcggtgtcctcgcc
gaagccctcctcgagcaggtcgccggcgttcgtctcgtgtcccacgtcgtctccgttggg
gcccagcacgccacggcctcgtcgacgcctactcccgcggacgaggcggcactgtgcgag
gcctcgatgcgcacactcaatccggaggataacgcccgcttcgaggcagccgtcgatgcg
gccaagcaggcgggtgacacgatcggcggcgtcgccgaagtgattgcatacgacgttcca
gtcggcttgggcactcacgtgaccgcgcgcgagcgcctcgatgcgcgcttggccgccgca
ctcatgtcgatccagtccgtcaagggcgttgagatcggagatggcttcgcgcaggccgcg
ctgctcggttccgcggcccacgacgaaatcgtgcggggcgaggatggtcacctgacgcgc
gcctccaaccacgccggaggcatcgaaggaggcacatccaacggcgcaccgatcgtcgca
cgcgctgctttcaagccaatctcgaccgttccgcacgccttgcgcagcgttgacctcgca
acgggtgaggaagcggtgggcttgcaccagcgctccgacacgtgccaggtcgtgcccggc
gcagtcatcgccgaggccgaggtggctctcgtcctcgcagatgctctgtcggatcacgca
ggcggccgatctgttggcgagatgcgcaggaatctcgaggcgtacctcgcggtcgtgggg
aagcgcgcatga

DBGET integrated database retrieval system