KEGG   Streptococcus oralis: SOR_0237Help
Entry
SOR_0237          CDS       T01476                                 

Gene name
alaT
Definition
(GenBank) aminotransferase AlaT, aminotransferase, class I
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sor  Streptococcus oralis
Pathway
sor00220  Arginine biosynthesis
sor00250  Alanine, aspartate and glutamate metabolism
sor00290  Valine, leucine and isoleucine biosynthesis
sor01100  Metabolic pathways
sor01110  Biosynthesis of secondary metabolites
sor01130  Biosynthesis of antibiotics
sor01210  2-Oxocarboxylic acid metabolism
sor01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sor00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SOR_0237 (alaT)
   00290 Valine, leucine and isoleucine biosynthesis
    SOR_0237 (alaT)
   00220 Arginine biosynthesis
    SOR_0237 (alaT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sor01007]
    SOR_0237 (alaT)
Enzymes [BR:sor01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SOR_0237 (alaT)
    2.6.1.66  valine---pyruvate transaminase
     SOR_0237 (alaT)
Amino acid related enzymes [BR:sor01007]
 Aminotransferase (transaminase)
  Class I
   SOR_0237 (alaT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 MHC_II_alpha
Motif
Other DBs
NCBI-ProteinID: CBY99924
UniProt: F2QGR3
LinkDB All DBs
Position
223167..224381
Genome map
AA seq 404 aa AA seqDB search
MKEYNKSSKLEHVAYDIRGPVLEEAMRMRANGEKILRLNTGNPAEFGFTAPDEVIHDLIM
NARDSEGYSDSKGIFSARKAIMQYCQLKKFPNVDIDDIYLGNGVSELIVMSMQGLLDNGD
EVLVPMPDYPLWTAAVSLAGGNAVHYICDEAAEWYPDIDDIKSKITSNTKAIVLINPNNP
TGALYPKELLLEIIEIARQNDLIIFADEIYDRMVMDGHVHTPVASLAPDVFCVSMNGLSK
SHRIAGFRVGWMVLSGPKHHVKGYIEGLNMLSNMRLCSNVLAQQVVQTSLGGHQSVDELL
LPGGRIYEQRNFIYNAIQDIPGLSAVKPKAGLYIFPKIDRNMYRIDDDEQFVLDFLKQEK
VLLVHGRGFNWKEPDHFRIVYLPRVDELAQIQEKMTRFLSQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatataacaagtctagtaagttagagcacgttgcctatgatatccgtggtcct
gttttggaagaagctatgcggatgcgagcaaacggagaaaagattttacgtctgaataca
gggaatccagcagaatttggctttacagcaccagatgaggtcattcatgacttgattatg
aatgcgcgtgatagtgagggatattctgactccaaagggattttctcagcccgcaaggcc
atcatgcagtattgccaactgaagaaatttcccaatgtagacattgatgatatctacctt
ggaaatggtgtcagtgagctgattgttatgtccatgcaagggcttttggataatggcgat
gaggtcttggtgcctatgccagactatcctctctggacagccgcggtcagtctagctggg
ggaaatgccgttcactatatctgtgatgaagctgcagagtggtaccctgatattgacgat
atcaagtcaaaaattacttccaacactaaggcaatcgttcttatcaatccgaacaaccca
actggagccctttatcctaaggaactcttgttggagattattgagattgctcgtcagaac
gatttgatcatctttgctgacgaaatctatgaccgcatggtgatggatggacatgtgcat
acgcctgtggcgagcttggcaccagatgttttctgtgtcagcatgaatggtctgtcaaaa
tcgcatcgtatcgctggttttcgtgtaggatggatggtcttgtctggtcctaagcaccat
gtcaagggctatatcgaaggtctcaatatgctatccaatatgcgtctttgctctaacgtt
ttggcccagcaagtagtacaaacttcactaggtgggcaccagtcagtggatgaattgctc
cttcctggtggacggatctatgagcaaagaaacttcatttacaatgctatccaagatatc
ccaggtttgtctgcggtcaagccgaaggcgggtctttatatcttccctaaaattgaccgc
aatatgtaccgcatcgatgatgatgaacagttcgttcttgatttcttgaagcaggaaaag
gttctcttggttcatggtcgtggttttaactggaaggaaccagaccatttccgtatcgtc
taccttcctcgtgtggacgaattggcgcaaatccaagaaaagatgacacgtttcttgagt
cagtatcgtagataa

DBGET integrated database retrieval system