KEGG   Streptococcus oralis: SOR_0548Help
Entry
SOR_0548          CDS       T01476                                 

Gene name
nanA
Definition
(GenBank) neuraminidase A
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
sor  Streptococcus oralis
Pathway
sor00511  Other glycan degradation
sor00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sor00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    SOR_0548 (nanA)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SOR_0548 (nanA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:sor02042]
    SOR_0548 (nanA)
Enzymes [BR:sor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SOR_0548 (nanA)
Bacterial toxins [BR:sor02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SOR_0548 (nanA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sialidase BNR_2 Laminin_G_3 BNR_3 YSIRK_signal Gram_pos_anchor BNR DUF4185
Motif
Other DBs
NCBI-ProteinID: CBZ00210
UniProt: F2QC42
LinkDB All DBs
Position
506049..509441
Genome map
AA seq 1130 aa AA seqDB search
MNYKSLNRKQRYGIRKFAVGAASVVIGTVVFGANPVLAQEQANAAGANTETVEPGQGLSE
LPKEASSGDLAHLDKDLAGKLAAAQDNGVVVDQDHLKKNESAESETPSSTGTLAEETNKE
EESEDQGAIPRDYYSRDLKNANPVLEKEDVETNATNGQRVDLSSELNKLKQLKNATVHME
FKPDASAPRFYNLFSVSSDTKENEYFTMSVLDNTALIEGRGANGEQFYDKYTDAPLKVRP
GQWNSVTFTVEQPTAELPHGRVRLYVNGVLSRTSLKSGNFIKDMPDVNQAQLGATKRGNK
TVWSSNLQVRNLTVYDRALSPDEVQTRSQLFERGELEQKLPEGAKVTEKEDVFEGGRNNQ
PNKDGIKSYRIPALLKTDKGTLIAGTDERRLHHSDWGDIGMVVRRSSDNGKTWGDRIVIS
NPRDNEHAKHAEWPSPVNIDMALVQDPETKRIFAIYDMFLESKAVFSLPGQAPKAYEQVG
DKVYQVLYKQGESGRYTIRENGEVFDPQNRKTDYRVVVDPKKPAYSDKGDLYKGNELIGN
IYFEYSEKNIFRVSNTNYLWMSYSDDDGKTWSAPKDITHGIRKDWMHFLGTGPGTGIALR
TGPHKGRLVIPVYTTNNVSYLNGSQSSRVIYSDDHGETWQAGEAVNDNRPVGNQTIHSST
MNNPGAQNTESTVVQLNNGDLKLFMRGLTGDLQVATSHDGGATWDKEIKRYHQVKDVYVQ
MSAIHTMHEGKEYILLSNAGGPGRNNGLVHLARVEANGELTWLKHNPIQSGKFAYNSLQE
LGNGEYGLLYEHADGNQNDYTLSYKKFNWDFLSKDRISPKEAKVKYAIQKWPGIIAMEFD
SEVLVNKAPTLQLANGKTATFMTQYDTKTLLFTIDPEDMGQRITGLAEGAIESMHNLPVS
LAGSKLSDGINGSEAAIHEVPEFTGGVNAEEAPVAEIPEYTGPLATVGEEPAPTVEKNEF
TGGVNAEEAPVAEMPEYTGPLSTVGEEPAPTVEKPEFTGGINAVEAAVHELPEFKGGVNA
VLAASNELPEYRGGANFVLAASNDLPEYKGGVNGAEAAVHELPEYKGEIKPVLTAANDKL
SLGQDVTYQAPAAKQDELPNTGSKETSSLLSLGLAGVLLSLFAFGKKRKE
NT seq 3393 nt NT seq  +upstreamnt  +downstreamnt
atgaattacaaatctttaaatcggaaacagcgatacggaattcgaaaatttgcagtcggt
gcagcatcggtagtgattggtacagtggtatttggagcaaatccagtcttagctcaagag
caagccaatgcagcaggagccaatacagaaactgtcgaacctggtcaaggtttatcagaa
ttgccaaaagaagcgtcctcgggagatcttgctcatttggataaagatttggctggcaaa
ttggcagcagctcaagacaacggcgttgtggtggaccaagatcatttgaaaaaaaatgag
agtgcagaatcagaaactccatcctctacgggaacccttgcagaagaaacaaataaggaa
gaggaatcagaggatcagggggctattcctcgtgactattactcaagagatttaaaaaat
gctaatcctgtccttgaaaaagaagatgttgaaaccaatgcaacaaatggtcagagagtt
gatttatcaagtgaactaaataaactaaagcaactaaaaaatgctacagttcacatggag
ttcaaaccagatgcatcagctccacgtttttacaatctcttctctgtatccagtgacacc
aaggaaaatgagtactttactatgtcggtccttgataatacagctcttattgaagggcgt
ggcgctaatggagagcagttctatgataagtatacagatgctcctttgaaagttcgtcct
ggacaatggaattcagtgacctttactgtcgaacaaccaacagcagagttacctcatggt
cgagttcgtctctatgtgaacggtgtcttatctcgaacaagcctcaaatctggtaacttt
atcaaagatatgccagatgttaatcaagctcaacttggagcaaccaaacggggcaataaa
acagtttggtcatcaaacctacaagtacgaaacctaaccgtttacgatcgtgctttaagc
ccagatgaagttcaaacacggagtcaattatttgaaagaggtgaattggaacagaaactt
cctgagggagcaaaagtcactgagaaagaagacgtctttgaaggtggtaggaacaatcaa
ccaaataaagatggtatcaagagttatcgtatcccagctcttctcaagacagataaagga
acgctgattgcaggaacggatgaaagacgtttgcaccattctgactggggagatattggg
atggttgttcgtcgcagctcagataatggaaaaacatggggagaccgaatcgtaatctca
aatcctcgtgacaatgagcacgctaaacatgcagaatggccatctccagttaatattgat
atggccttggtgcaagaccctgaaacaaagagaatttttgcaatttatgacatgttcctt
gaaagtaaggcagtattttcattgccggggcaagctccgaaagcttatgaacaagtggga
gataaagtttatcaagttttatataagcaaggagaatcaggtcgctatacgattcgagaa
aacggagaggttttcgaccctcaaaatagaaagacagattatcgtgttgtcgttgaccct
aaaaaaccagcctacagcgataagggagatttgtataaagggaatgagctaatcggaaat
atttattttgaatatagcgaaaagaatatttttagagtttccaataccaactacctatgg
atgtcctacagtgatgacgatgggaagacttggtctgcaccaaaagatattactcatggg
attcggaaagattggatgcacttcctaggaactggacctggtactgggattgccttacgt
acaggacctcataagggaagactggtgattccagtttatacaacaaacaacgtttcctac
ctaaatggttcacaatcatctcgtgtaatttattcagatgatcatggtgaaacatggcaa
gcaggggaagcagttaatgataaccgcccagtaggcaaccaaaccattcattcttcaact
atgaataatccaggtgcccaaaatacggagtcgactgttgttcagttgaataatggggat
ctcaagctctttatgcgtgggttgactggtgatcttcaggttgcgaccagtcatgatggg
ggagcaacgtgggataaggaaatcaaacgatatcatcaagtaaaagacgtttatgttcaa
atgtccgctattcacaccatgcatgaaggaaaggaatacattctactcagcaatgctggt
ggccctggacgcaacaatggtttggttcacctggcccgtgttgaggcgaatggtgagttg
acgtggctaaaacacaatcctatacaaagtggtaagtttgcgtacaactcactccaagaa
ctcggaaatggcgaatatggtttgctttatgagcatgcggatggcaatcaaaacgattat
actttatcctataagaaattcaactgggatttcttaagcaaagacagaatttctcctaaa
gaagcaaaagtaaaatatgctatccaaaaatggccaggtattattgccatggagttcgat
tcggaagtattggtcaacaaggctccgacccttcaattggcaaatggcaagacagcaacc
tttatgacccagtacgatacaaaaactctcctattcacaatagatccagaggatatgggt
caaagaattacaggtctagctgagggtgcaattgaaagcatgcacaatttaccagtttct
ttagctggctctaaactaagcgatggtattaatggcagtgaagctgctatccatgaggtg
ccggagttcacaggtggtgttaatgctgaggaagccccagtggcagagataccagagtac
actggaccattggcaacagtaggagaagaaccagctccaacagtagaaaaaaacgaattc
actggtggagtcaatgctgaggaagccccagtggcagagatgccagagtacaccggtcca
ttatcaacagtaggagaagaaccagcgccaacggttgaaaagcctgaatttacaggtggg
atcaacgctgttgaggcagcagtccatgaacttccagagtttaaaggtggcgttaacgcg
gttctagcagcctcaaacgagcttcctgaatatagaggaggtgctaactttgtcttggca
gcttcaaatgacctgccagagtataagggtggcgtcaatggtgctgaggcggcagttcat
gaacttccagagtataagggagagatcaaaccagtcttaacggctgcaaatgacaaacta
tctctaggacaagatgtgacctatcaagcgccagcagctaaacaagatgaacttccgaat
acgggaagcaaggaaacaagctcactgctttcccttggtcttgcaggtgttcttttatcc
ttgtttgcatttggcaagaagagaaaagaataa

DBGET integrated database retrieval system