KEGG   Streptococcus oralis: SOR_1165Help
Entry
SOR_1165          CDS       T01476                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sor  Streptococcus oralis
Pathway
sor00620  Pyruvate metabolism
sor00680  Methane metabolism
sor01100  Metabolic pathways
sor01120  Microbial metabolism in diverse environments
sor01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SOR_1165 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    SOR_1165 (ppc)
Enzymes [BR:sor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SOR_1165 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CBZ00823
UniProt: F2QDV4
LinkDB All DBs
Position
complement(1138287..1140983)
Genome map
AA seq 898 aa AA seqDB search
MSLQKLENYSNKAVVQEEVLILTELLEDITKNMLAPETFEKIIQLKELSTSEDYQGLNDL
VTSLSNEEMIYISRYFSILPLLINISEDVDLAYEINHQNNVDQDYLGKLSTTIKMVAEKE
NAAEILEKLNVVPVLTAHPTQVQRKSMLDLTNHIHTLLRKYRDVKLGLINKEKWHTDLRR
YIEIIMQTDMIREKKLKVTNEITNVMEYYQSSFLNAVPRLTAEYKKMAKEQGIDLQHPKP
ITMGMWIGGDRDGNPFVTAETLNKSALTQCEVIMNYYDEKIYNLYREFSLSTSIVNVSDK
VREMALKSQDNSIYREKELYRRALFDIQAKMQATKAYLIEDKELQPRYATADEFYQDLLA
IRDSLLENKGEYLISGEFVELMQAVEIFGFYLASIDMRQDSSVHEACVAELLASAGINDH
YSDLSEDEKCTLLLKELEEDPRILSATHAQKSELLEKELSIFKAARKLKDKLGENVIRQT
IISHATSVSDMLELAIMLKEVGLVDAQKARVQIVPLFETIEDLDHSEETMRRYFSLPLAK
KWIASKDNYQEIMLGYSDSNKDGGYLSSCWTLYKAQQQLTAIGDEFGVKVTFFHGRGGTV
GRGGGPTYEAITSQPLKSIKDRIRLTEQGEVIGNKYGNKDAAYYNLEMLVSAAINRMITK
KKSDTNTSNRYEAIMDQVVDRSYDIYRDLVFGNEHFYDYFFESSPIKAISSFNIGSRPAA
RKTITEIGGLRAIPWVFSWSQSRVMFPGWYGVGSSFKEFIDQDPKNIEFLRDMYQNWPFF
QSLLSNVDMVLSKSNMNIAFEYAKLCEDEEVQAIYYTILDEWQLTKDVILAIEGYDELLA
ENSYLKDSLNYRMPYFNILNYIQLELIKRQRRGELSADEEKLIHTTINGIATGLRNSG
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttcaaaaattagaaaactatagtaataaagcagttgtccaagaagaagtcttg
attctgactgagctattagaagatattacaaaaaatatgctggcgccagaaacctttgaa
aagattatccagttaaaggaattatcaactagcgaggattatcaagggctcaatgaccta
gtgacaagtctttcgaatgaagaaatgatttacatttcacgctatttctctatccttcca
cttttgattaatatctccgaggatgtggatttggcctatgaaattaatcaccaaaacaat
gtggaccaagactatctaggaaaactatctacaacgattaagatggtagctgaaaaagaa
aatgcagctgaaattttagaaaagttaaatgtcgttcctgtcttgaccgcccatccaacg
caagtacaacgcaagagtatgctggatttgaccaaccatatccatacgctcttgcgcaag
taccgtgatgtcaaactcggcttgattaataaagaaaaatggcacacagatctccgtcgt
tacattgaaattatcatgcaaacggacatgattcgtgagaagaaattgaaagtaaccaac
gaaatcaccaacgtgatggagtactaccaaagttctttcctgaatgctgttccacgtttg
acagctgagtataaaaaaatggccaaagaacaaggtatcgatctccaacatccaaaaccg
attaccatggggatgtggatcggaggagaccgtgatggaaatcctttcgtaactgcagaa
accctcaacaaatcagccttgactcagtgtgaagtcatcatgaactactatgatgaaaag
atttataatctttatcgtgaattttcactgtcaaccagcatcgtgaatgtcagcgacaag
gttcgtgagatggcgctgaagtcacaagataactccatttaccgtgaaaaagaactctat
cgtcgtgctctttttgacattcaagctaagatgcaggcaaccaaggcttatctcattgaa
gacaaggaacttcagcctagatatgccactgcagatgaattctatcaagatttgttggcg
attcgcgattctctccttgaaaacaaaggggaatacctgatttctggagaatttgtcgag
ttgatgcaggcagttgaaatctttggcttctatcttgcctctatcgacatgcgccaggat
tctagtgttcacgaagcctgtgtggctgaattgctagcatcagctggtatcaacgaccac
tatagcgacctttctgaagacgaaaaatgtaccctcctcttaaaagagttggaagaagat
cctcgtatcctctcagcgactcatgctcaaaagtcagaacttcttgagaaggaactgtct
atctttaaagctgcccgcaagttgaaggataaactgggtgaaaacgtcattcgtcaaacc
atcatttctcacgcaacaagtgtatccgatatgttagagctagccattatgcttaaggaa
gtcggtttggtggatgcccaaaaagcccgcgttcagattgttcccctctttgaaacgatc
gaggacttggatcactcagaagaaaccatgagaagatatttctctcttcctttggctaaa
aaatggattgcttcaaaagacaactaccaagaaatcatgcttggttactctgatagtaac
aaggacggtggttacctatcatcatgttggactctctataaagcgcaacaacaactgact
gctattggggatgaatttggcgttaaagtcactttcttccatggtcgtggtggtactgtg
ggtcgtggtggtggaccaacttatgaagccatcacatctcaaccacttaagtctattaag
gaccgtatccgtttgactgagcaaggagaagtgattggaaacaaatacggtaacaaagat
gctgcctattataaccttgaaatgttggtttctgcagccattaaccgtatgattaccaag
aagaagagtgataccaatacatcaaaccgttacgaagccatcatggaccaagtagtggac
cgcagctacgatatctaccgtgacttggtctttggaaatgaacatttctatgactatttc
tttgaatcaagcccaatcaaggctatttcaagcttcaatatcggttcgcgtccagcagct
cgtaagaccatcactgaaattggcggtttgcgcgctatcccttgggtcttctcatggtca
caaagccgtgtcatgttccctggatggtatggtgtaggatcaagctttaaagagtttatt
gatcaagatccgaaaaatatcgagtttcttcgtgatatgtaccaaaactggcctttcttc
caatctttgctttccaatgtagacatggtcttgtcaaagtctaacatgaatattgccttt
gaatatgccaagctctgtgaagacgaagaagtgcaagctatctactacactattttagat
gaatggcagttaaccaaggatgttattttagctatcgaaggttatgatgaactcttagca
gaaaactcttacctaaaagacagcctaaactatcgtatgccttactttaatatccttaac
tacatccagttggagttgattaaacgtcaacgtcgcggcgaattgtcggcagacgaagaa
aaactgatccatacaaccattaacggaattgcaactggtttacgtaattcaggctga

DBGET integrated database retrieval system