KEGG   Streptococcus oralis: SOR_1534Help
Entry
SOR_1534          CDS       T01476                                 

Definition
(GenBank) sucrose-6-phosphate hydrolase, putative
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
sor  Streptococcus oralis
Pathway
sor00052  Galactose metabolism
sor00500  Starch and sucrose metabolism
sor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SOR_1534
   00500 Starch and sucrose metabolism
    SOR_1534
Enzymes [BR:sor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     SOR_1534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-ProteinID: CBZ01186
UniProt: F2QEW7
LinkDB All DBs
Position
1487618..1489072
Genome map
AA seq 484 aa AA seqDB search
MEWTTERRYRRYEDWSNDEIKQIKEKMAQSPWHTRYHVEPKMGLLNDPNGFSYFDGKWIL
FYQNFPFGAAHGLKSWVHLESDDLVHFTETGVKVLPDTPLDSHGAYSGSAMQFGDQLFLF
YTGNVRDENWIRHPYQIGALMDKDGKITKIDKILIDQPADSTDHFRDPQIFNFKGQYYAI
VGGQDLEKKGFVRLYKAVDNDYTNWQAVGDLDFANDRTAYMMECPNLVFVGEQPVLLYCP
QGLDKIVLDYDNIYPNMYKIGASFDPENAEMVDVSPLQNLDYGFEAYATQAFNAPDGRAL
AVSWLGLPDVSYPSDRFDHQGTFSLVKELTIKDGKLYQYPVSAVKELRSSEEVFSNRTQT
NNTYELELNLEANSQSEIVLLADKEGKGLSINFDLVNGQVTVDRSQAGEQYAQEFGTTRS
CPINNQATTATIFIDKSVFEIFINKGEKVFSGRVFPHADQNGILIKSGNPTGTYYELDYG
RKTN
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggaatggacaactgagcgccgttatagacgctatgaagactggtctaatgatgaaatc
aagcaaataaaggaaaagatggcacaatctccttggcatactcgttaccatgttgagcct
aaaatggggcttctcaatgatccaaatggcttttcttattttgatggcaaatggattctc
ttttaccagaacttcccctttggtgcagcccatgggttgaaatcttgggtgcaccttgaa
agtgatgatttagtgcactttacagaaactggagtcaaagttttgccagatactccatta
gatagccacggtgcctactctgggtctgccatgcagtttggcgatcagttgttcctattt
tatactggaaatgtccgtgatgaaaactggatccgtcacccctaccagattggggctttg
atggataaagatggcaaaatcacaaagattgacaagatcttgattgaccagccagcagac
tctactgaccacttccgcgacccacaaatttttaactttaaaggtcaatattatgctatc
gtcggtggacaggacttggagaaaaaaggcttcgtccgtctctacaaggctgtggacaat
gactatacaaactggcaagcagttggcgaccttgactttgctaacgaccgcactgcctac
atgatggaatgcccaaatctggtctttgtaggggagcaacctgtccttctctactgccca
caaggattggataagattgttctagactatgataatatctatccaaacatgtacaaaatc
ggtgcttcctttgatcctgaaaatgccgaaatggtagatgtgtctccattgcaaaatcta
gactatggttttgaagcctatgcaactcaagcctttaacgctcctgatggacgtgcattg
gcagtaagttggcttggattaccagatgtttcttacccatctgaccgttttgaccaccaa
ggaaccttctcattggtcaaagaactcactatcaaagatggcaaactctaccaatatcct
gtctcagccgtcaaagaacttcgttcttctgaagaggtcttctcaaatcgtactcaaacc
aataacacctatgaactggagctcaacttggaggccaatagccaaagcgagattgtcttg
ctcgctgataaagaaggcaaggggctttcaatcaactttgaccttgtcaatggacaggtg
acagtggatcgtagtcaggctggtgaacagtatgcccaagaatttggtacaactcgttct
tgccctatcaataaccaagctacaactgctactatcttcatcgataagtcagtctttgaa
attttcatcaataaaggagaaaaagtattttctggtcgtgtcttcccacatgcagaccaa
aatggtatcctcatcaaatctggaaatccaaccggaacttactatgaattagattatggt
cgcaaaactaactga

DBGET integrated database retrieval system