KEGG   Streptococcus oralis: SOR_1587Help
Entry
SOR_1587          CDS       T01476                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
sor  Streptococcus oralis
Pathway
sor00970  Aminoacyl-tRNA biosynthesis
sor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sor00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SOR_1587
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sor03029]
    SOR_1587
Enzymes [BR:sor01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SOR_1587
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SOR_1587
Mitochondrial biogenesis [BR:sor03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SOR_1587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: CBZ01239
UniProt: F2QF20
LinkDB All DBs
Position
1544633..1546099
Genome map
AA seq 488 aa AA seqDB search
MTFNNKTIEDLHNLLVSKEISATELTQATLEDIKSREKAINAFVTIAEEQALAQAKAIDE
AGIDADNVLSGIPLAIKDNISTDGILTTAASKMLYNYEPIFDATAVANAKSKGMIVVGKT
NMDEFAMGGSGETSYYGATKNAWDHSKVPGGSSSGSAAAVASGQVRLSLGSDTGGSIRQP
AAFNGIVGLKPTYGTVSRFGLIAFGSSLDQIGPFAPTVKENALLLNAIASEDAKDSTSAP
VRIADFTSKIGQDIKGMKIALPKEYLGEGIDPEVKETILSAAKHFEKLGAIVEEVSLPHS
KYGVAVYYIIASSEASSNLQRFDGIRYGYRADDATNLDEIYVNSRSQGFGEEVKRRIMLG
TFSLSSGYYDAYYKKAGQVRTLIIQDFEKVFADYDLILGPTAPSIAYDLDSLNHDPVAMY
LADLLTIPVNLAGLPGISIPAGFSQGLPVGLQLIGPKYSEETIYQAAAAFEATTDYHKQQ
PVIFGGDN
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaataacaaaacgattgaagacttgcacaacctccttgtatctaaggagatt
tcagctactgaattgacccaagccacgcttgaagatatcaagtctcgcgagaaagctatc
aatgcttttgtcactatcgctgaagaacaagcccttgctcaagctaaagccattgatgaa
gctggaattgacgcggataatgtcctttcaggaattccactggctattaaggataatatt
tctactgacggcatcctcacaactgctgcctcaaaaatgctctacaactacgaacctatc
tttgatgcaacagctgttgccaatgcaaaatctaagggcatgatcgttgttgggaaaacc
aacatggacgaatttgccatgggtggttctggtgagacttcctactacggcgcaacaaaa
aatgcttgggaccacagcaaggttcctggtggatcatcaagtggttctgccgcagctgta
gcttcaggtcaagtccgcttgtcacttggttctgatacgggggggtctatccgccaacct
gctgccttcaacgggatcgttggtctcaaaccaacctacggaacagtttcacgtttcggc
ctcattgcctttggtagctctctagaccaaatcgggccttttgctccaactgttaaggaa
aatgccctcttgctcaatgcgattgccagcgaagatgccaaagactctacctctgctcct
gtccgcatcgctgactttacttcaaaaatcggccaagatatcaagggaatgaaaattgct
ttgcctaaggaataccttggtgaagggattgatccagaggttaaggaaaccattctgagt
gcagccaaacactttgaaaaacttggtgctatcgtcgaagaagtcagccttcctcactct
aaatacggtgttgccgtttactacatcatcgcttcatcagaagcctcatcaaacttgcaa
cgctttgacggtatccgttacggctaccgcgcagatgatgcgactaatcttgatgaaatc
tatgtaaacagccgtagccaaggtttcggtgaagaggtaaaacgccgtatcatgctaggt
actttcagcctttcatcaggttactatgatgcctactataagaaagctggtcaggtccgt
accctcatcatccaagatttcgaaaaagtctttgcggattacgacttgattttgggacca
actgctccaagcattgcctatgatttggactccctcaaccacgacccagttgccatgtac
ttggctgacctcttgacaatcccagtcaacttggcaggtctcccagggatttcgattcct
gctggattctctcaaggtctacctgtcgggctccaattgattggtcctaaatactctgag
gaaaccatttaccaagctgctgctgcctttgaagcaacaacagactaccacaaacaacaa
cccgtgatttttggaggtgacaactaa

DBGET integrated database retrieval system