KEGG   Streptococcus oralis: SOR_1600Help
Entry
SOR_1600          CDS       T01476                                 

Gene name
fabA
Definition
(GenBank) 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratases, COG0764
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
sor  Streptococcus oralis
Pathway
sor00061  Fatty acid biosynthesis
sor00780  Biotin metabolism
sor01100  Metabolic pathways
sor01212  Fatty acid metabolism
Module
sor_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sor00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SOR_1600 (fabA)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SOR_1600 (fabA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sor01004]
    SOR_1600 (fabA)
Enzymes [BR:sor01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     SOR_1600 (fabA)
Lipid biosynthesis proteins [BR:sor01004]
 Fatty acid synthase
  Component type
   SOR_1600 (fabA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: CBZ01252
UniProt: F2QF33
LinkDB All DBs
Position
complement(1556257..1556679)
Genome map
AA seq 140 aa AA seqDB search
MIDIQGIKEALPHRYPMLLVDRVLEVSEDTIVAIKNVTINEPFFNGHFPQYPVMPGVLIM
EALAQTAGVLELSKPENKGKLVFYAGMDKVKFKKQVVPGDQLVMTATFVKRRGTIAVVEA
KAEVDGKLAASGTLTFAIGN
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatattcaaggaatcaaagaagctctaccccatcgctaccccatgctcctagtg
gatcgtgtcttggaagtgagcgaagataccattgttgccattaaaaatgtgaccatcaac
gaacctttcttcaatggtcattttcctcaatacccagtcatgccaggtgttcttatcatg
gaagccttggctcagactgctggtgtcttggaattgtccaaacctgaaaataaagggaaa
ctggtcttctacgctggcatggacaaggttaagtttaagaagcaagttgtaccaggtgat
caattagtcatgacggctacctttgtaaaacgtcgtggtacgattgccgtggttgaagca
aaggctgaagtagatggcaagcttgcagcgagtggtactcttacctttgcaattggaaac
taa

DBGET integrated database retrieval system