KEGG   Solanum tuberosum (potato): 102577859Help
Entry
102577859         CDS       T02981                                 

Gene name
HXKRP1
Definition
(RefSeq) hexokinase-related protein 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00010  Glycolysis / Gluconeogenesis
sot00051  Fructose and mannose metabolism
sot00052  Galactose metabolism
sot00500  Starch and sucrose metabolism
sot00520  Amino sugar and nucleotide sugar metabolism
sot01100  Metabolic pathways
sot01110  Biosynthesis of secondary metabolites
sot01200  Carbon metabolism
Module
sot_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sot_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102577859 (HXKRP1)
   00051 Fructose and mannose metabolism
    102577859 (HXKRP1)
   00052 Galactose metabolism
    102577859 (HXKRP1)
   00500 Starch and sucrose metabolism
    102577859 (HXKRP1)
   00520 Amino sugar and nucleotide sugar metabolism
    102577859 (HXKRP1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    102577859 (HXKRP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sot04131]
    102577859 (HXKRP1)
Enzymes [BR:sot01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     102577859 (HXKRP1)
Membrane trafficking [BR:sot04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    102577859 (HXKRP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 102577859
NCBI-ProteinID: NP_001275315
UniProt: Q8VWX3
LinkDB All DBs
Position
Un
AA seq 499 aa AA seqDB search
MSVTVSSPAVRSFHVSRSPHKTIYRPRVIMSAVRSSDSLGVAPILTKLQKDCATPLPVLR
HVADAMADDMRAGLAVDGGSDLKMILSYVDTLPTGNEKGLFYALDLGGTNFRVLRVQLGG
KEERVVATEFEQVSIPPELMFATSEELFDFIASALGKFAQKEGGNFELQQGRTREIGFTF
SFPVKQTSIRTGILIKWTKGFAVSGTAGKDVVACLNEAMERRGMDMQVSALVNDTVGTLA
GARYWDDDAMVAVILGTGTNACYVERVDAIPKLTKRMSKSPITIVNTEWGAFSNGLPLTE
FDREMDAESINPGEQIFEKTISGMYLGEIVRRVLVKMSKVGGLFGGSYVPEKLVTPFVLR
TPDICAMQQDTSRDLEAVESVLYDVAGVKSDLSARKTVVDICDTIAKRGGRLAGAGIVGI
LQKMEEDSKGLIFGKRAVVAMDGGLYEHYPQYRGYLQEAVTELLGSEISKNVVIEHSKDG
SGIGAALLAAANSKYEHDY
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtcaccgttagctcgccggccgtccgatccttccatgtttcacgatcacctcat
aaaacgatctataggccacgtgtcattatgtctgccgtccgatctagtgatagcttagga
gtagcaccaattttgactaagttgcagaaagactgtgctactcctctcccagttttgcgc
cacgtggcggatgcaatggccgatgatatgcgggccgggcttgccgtcgatggcggcagt
gatctgaagatgatccttagttatgtcgacactctaccaactgggaatgagaaaggcttg
ttttatgcgttggaccttggtggtacaaatttccgagtgctaagggtgcagctaggtggt
aaagaagagcgtgtagtcgccactgagtttgagcaagtctctatacccccagaattgatg
tttgctacctccgaggagctgttcgatttcatagcttctgcgctaggaaaatttgcacaa
aaggaaggtggtaattttgagttgcaacagggacggacaagggaaataggattcacgttt
tcttttccagtgaaacagacttcaataagaactggaatcctaatcaaatggacaaaaggt
tttgctgtctctggaactgcaggaaaagatgttgttgcttgtttaaatgaagccatggag
aggcggggaatggatatgcaagtgtctgccctggtcaatgacactgtgggaacacttgcc
ggagcaagatactgggatgatgatgccatggttgctgtcattcttgggactggaaccaat
gcttgctatgtagaacgtgtggatgctattcctaagctgacaaaaaggatgtccaagtct
ccaataacgattgtgaatactgaatggggagctttctcaaatggccttcctttaactgag
tttgatagagaaatggatgccgagagcattaaccctggtgagcagatttttgaaaagacc
atctccggtatgtaccttggggaaattgtgagacgggtgctggtcaaaatgtccaaggtt
gggggcttatttggtggcagctatgttccggaaaagttagtcactccatttgtgctgagg
acacctgatatatgtgccatgcagcaggatacatcaagagatcttgaagctgttgaatct
gtcctctatgatgtagctggggtaaaatccgatctaagtgcaaggaaaacagtcgtggac
atttgcgatactattgcaaaacgagggggtcgtctggctggtgcaggaattgttgggatt
ctacagaaaatggaggaggattctaaaggcctcatctttggtaaaagagcagttgtagca
atggatggaggcttatacgagcactatcctcagtacagaggatacctccaagaagctgtc
acagagttactaggctcggaaatttcgaaaaatgtagtgatagaacattcaaaagatggt
tctggaattggagctgcattattagctgctgcaaactcaaagtatgaacatgattattaa

DBGET integrated database retrieval system