KEGG   Solanum tuberosum (potato): 102578320
Entry
102578320         CDS       T02981                                 

Definition
(RefSeq) acetyl-CoA-benzylalcohol acetyltransferase-like
  KO
K13065  shikimate O-hydroxycinnamoyltransferase [EC:2.3.1.133]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00940  Phenylpropanoid biosynthesis
sot00941  Flavonoid biosynthesis
sot00945  Stilbenoid, diarylheptanoid and gingerol biosynthesis
sot01100  Metabolic pathways
sot01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    102578320
   00945 Stilbenoid, diarylheptanoid and gingerol biosynthesis
    102578320
   00941 Flavonoid biosynthesis
    102578320
Enzymes [BR:sot01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.133  shikimate O-hydroxycinnamoyltransferase
     102578320
SSDB
Motif
Pfam: Transferase
Other DBs
NCBI-GeneID: 102578320
NCBI-ProteinID: XP_006367986
LinkDB
Position
Un
AA seq 470 aa
MFQAKNLTKLNTRLYTMSQITTQNLNGTCIQIEILNEKLIKPSLPTPNHLNSYKLSFFDQ
IAPNFAVPLLYFYPPVPPENSHLQCVEEVHKQLQNSLSEVLTKFYPLAGRLSEDGTSIEC
HDQGVIYLEAKVNCQLNEFLDKAYKDSDLVKIFVPPIRIRLAELPNRPMMAIQATMFEHG
GLVLAVQVVHTLGDGFSGCAITDEWAKVSRMEKGNVRNLQFRSDLGEVFPPRDNIFEMIK
KGRPRGYEMKIATRIFMFDEIAISKLKENVNKFMSYSSRVEVVTALIWRSLMRVVRLRQG
HNRPSMLQFAINLRGRGSPKVVGEDQNFFGNFYLDIPIKYVSSHSNQDPELHEIVTLIRN
AKNKVLSEIANASSEEIFSILIESLNQIREGYNDDEIDLYPTSSLCKFPLNESDFGWAKP
IWVSRVNVPFQMFFLMDSKNGIEARVCLNEDDMIKLEKDVDIVEFSYVPK
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgtttcaagctaaaaatttaaccaaattaaacactagattatatactatgagccaaatt
acaacacaaaatttgaatggtacttgtattcaaattgaaatcttgaatgaaaaacttata
aaaccatcgttaccaactccaaatcatctcaattcctacaagttatcattttttgatcaa
attgctcctaattttgctgtaccccttctttacttctaccctccagttccaccagaaaac
tcccacctacaatgcgtcgaagaagttcataaacaactacaaaactcactgtctgaagtt
ctaaccaagttctatccacttgctggaaggttgtctgaagatggtacttccattgaatgt
catgaccaaggggttatttacttggaagcaaaggtgaattgccaattgaatgaatttcta
gacaaagcatacaaagatagtgaccttgtcaaaatctttgtaccacctataagaattagg
ctagctgaattgccaaatagaccaatgatggcaattcaggccaccatgttcgaacatggt
ggcctagtgctagccgtgcaagtagtccacacattaggtgatggattctctggctgcgca
atcactgatgagtgggctaaggttagtcgaatggagaaggggaatgtgagaaatttacaa
tttcgttcggatttaggggaagtatttccacctagggataatattttcgagatgattaaa
aaaggtaggcctagaggatatgaaatgaaaattgctacaagaattttcatgtttgatgaa
attgcaatatctaagttgaaggaaaatgtgaacaagtttatgagttattcatcaagagtt
gaagttgtgactgcacttatttggagaagcctaatgcgtgttgtgaggttgaggcagggt
cacaataggccatccatgctacaatttgccataaatttaagaggaagaggatctccaaaa
gttgtaggggaagatcaaaacttttttggaaacttctatcttgacattccaatcaaatat
gtgtcatctcatagcaatcaagatccagaattacatgaaattgtaaccttaattaggaat
gcaaagaacaaagttctatcagaaattgcaaatgcttcaagtgaagagattttctcaata
ttaattgagtcattgaatcaaataagagaagggtataatgatgatgaaattgacctttat
ccaacttcaagtttgtgtaaatttccactaaatgagtctgattttggatgggctaaacca
atttgggtgagcagagtaaatgtgccattccaaatgttcttcttgatggactcaaaaaat
ggaattgaagctagagtttgcttgaatgaagatgatatgattaagttggaaaaagatgtt
gatattgtggagtttagttatgtgccaaagtag

DBGET integrated database retrieval system